SecReT6
Protein ID: 339487743
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2840
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3157973..3158959 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDF8FXM7
KEGG IDppt:PPS_2840
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-97, Aligned region: 1..305
Protein Sequence: 328 a.a.     [Download]
>gi|339487743|ref|YP_004702271.1| unnamed protein product [Pseudomonas putida S16]
MRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSDLHFEREGKVSPAGLPLSEVQVTFMGLVG
PSGVLPRPYTELLLERHVHYRDDAAHAFLDIFSHRMTTLFYEAWQKYKFHIEHERNGTSGFDGYLLNLVG
LGPRAQQLKFEQQPTALRRELFSYFAGLLSQKPRNALNLERMLGFYFSLPIKVRQFAGRWLHLQPEQCTQ
LGRRNAQLGHSAVAGNRVWDYQSCIRIELGPLSLADYQRFQPGTACYRKLVELVRFYIGAELDFEIAPRL
KREAVPRAQLGRSGNVALGWLGWLKRPGRDAEPSRCAVFHIPYDGVAL
 
Nucleotide Sequence: 987 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3157973-3158959 Pseudomonas putida S16 chromosome, complete genome
GTGCGCCTGCTCCGCCTGCACTACAGCCGTACCGGGCGCATGGACCTGGCAACCCGGCCGCACGAAGACC
CGCTGCGTTTTCGTACCCAGCTGTCGCTGGCGTTCCCGGCCAGCGAGGTCAGCGACCTGCACTTCGAGCG
CGAAGGCAAGGTGTCGCCGGCCGGCTTGCCGCTGTCGGAAGTGCAGGTCACCTTCATGGGCCTGGTCGGG
CCGTCAGGCGTACTGCCGCGCCCGTATACCGAGCTGCTGCTGGAGCGCCACGTGCACTATCGCGACGATG
CCGCCCACGCGTTTCTCGACATCTTCTCGCACCGCATGACCACGCTGTTCTACGAGGCCTGGCAGAAGTA
CAAATTTCATATCGAGCACGAACGCAATGGCACTTCGGGCTTCGATGGCTACCTGCTCAACCTGGTCGGC
CTCGGCCCGCGCGCGCAGCAACTCAAGTTCGAGCAGCAACCAACCGCGCTGCGCCGCGAGCTGTTCAGCT
ACTTTGCCGGCCTGCTCAGCCAGAAGCCGCGCAACGCGCTGAACCTCGAACGCATGCTCGGCTTCTATTT
CTCGCTGCCGATCAAGGTCCGCCAATTCGCCGGGCGCTGGCTGCACCTGCAGCCCGAACAATGCACCCAG
CTCGGCCGCCGCAATGCCCAGCTCGGCCACAGCGCCGTAGCCGGCAACCGGGTCTGGGACTACCAGTCGT
GCATCCGCATCGAGCTGGGCCCGCTAAGCCTGGCCGACTACCAGCGCTTCCAGCCGGGCACCGCGTGCTA
CCGCAAGCTGGTCGAGCTGGTGCGCTTCTATATAGGCGCCGAACTGGATTTCGAAATTGCCCCGCGCCTC
AAGCGCGAGGCGGTGCCACGCGCCCAGCTGGGCCGCAGTGGCAATGTCGCCCTGGGCTGGCTGGGCTGGC
TCAAACGCCCTGGTCGTGACGCGGAGCCTTCGCGTTGCGCCGTCTTCCACATTCCTTACGATGGGGTCGC
CTTGTGA
 Primer design