SecReT6
Protein ID: 339487744
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2841
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3158956..3161541 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDF8FXM8
KEGG IDppt:PPS_2841
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.70E-44, Aligned region: 34..46
AAA_2 [PF07724], Evalue: 6.70E-44, Aligned region: 221..241
AAA_2 [PF07724], Evalue: 6.70E-44, Aligned region: 592..759
AAA_2 [PF07724], Evalue: 6.70E-44, Aligned region: 813..833
AAA [PF00004], Evalue: 2.20E-19, Aligned region: 61..79
AAA [PF00004], Evalue: 2.20E-19, Aligned region: 221..334
AAA [PF00004], Evalue: 2.20E-19, Aligned region: 598..716
AAA_5 [PF07728], Evalue: 2.90E-14, Aligned region: 221..243
AAA_5 [PF07728], Evalue: 2.90E-14, Aligned region: 597..718
ClpB_D2-small [PF10431], Evalue: 5.60E-14, Aligned region: 768..839
AAA_22 [PF13401], Evalue: 5.30E-10, Aligned region: 220..307
AAA_22 [PF13401], Evalue: 5.30E-10, Aligned region: 338..442
AAA_22 [PF13401], Evalue: 5.30E-10, Aligned region: 595..634
AAA_22 [PF13401], Evalue: 5.30E-10, Aligned region: 709..748
AAA_16 [PF13191], Evalue: 1.30E-08, Aligned region: 33..153
AAA_16 [PF13191], Evalue: 1.30E-08, Aligned region: 198..244
AAA_16 [PF13191], Evalue: 1.30E-08, Aligned region: 265..299
AAA_16 [PF13191], Evalue: 1.30E-08, Aligned region: 458..516
AAA_16 [PF13191], Evalue: 1.30E-08, Aligned region: 592..638
AAA_16 [PF13191], Evalue: 1.30E-08, Aligned region: 662..686
AAA_16 [PF13191], Evalue: 1.30E-08, Aligned region: 784..799
Clp_N [PF02861], Evalue: 5.50E-08, Aligned region: 21..73
Clp_N [PF02861], Evalue: 5.50E-08, Aligned region: 103..124
Sigma54_activat [PF00158], Evalue: 5.80E-07, Aligned region: 217..254
Sigma54_activat [PF00158], Evalue: 5.80E-07, Aligned region: 597..723
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 200..235
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 274..375
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 596..639
AAA_19 [PF13245], Evalue: 4.50E-06, Aligned region: 221..242
AAA_19 [PF13245], Evalue: 4.50E-06, Aligned region: 595..619
AAA_17 [PF13207], Evalue: 9.60E-06, Aligned region: 221..315
AAA_17 [PF13207], Evalue: 9.60E-06, Aligned region: 598..635
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 221..250
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 597..622
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 705..745
AAA_14 [PF13173], Evalue: 4.40E-05, Aligned region: 221..354
AAA_14 [PF13173], Evalue: 4.40E-05, Aligned region: 596..678
IstB_IS21 [PF01695], Evalue: 6.20E-05, Aligned region: 215..243
IstB_IS21 [PF01695], Evalue: 6.20E-05, Aligned region: 597..616
AAA_18 [PF13238], Evalue: 0.00053, Aligned region: 221..263
AAA_18 [PF13238], Evalue: 0.00053, Aligned region: 599..622
Zeta_toxin [PF06414], Evalue: 0.00084, Aligned region: 216..245
Zeta_toxin [PF06414], Evalue: 0.00084, Aligned region: 591..637
AAA_25 [PF13481], Evalue: 0.00092, Aligned region: 221..245
AAA_25 [PF13481], Evalue: 0.00092, Aligned region: 278..316
AAA_25 [PF13481], Evalue: 0.00092, Aligned region: 346..377
AAA_25 [PF13481], Evalue: 0.00092, Aligned region: 474..493
AAA_25 [PF13481], Evalue: 0.00092, Aligned region: 595..621
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 214..237
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 595..622
AAA_23 [PF13476], Evalue: 0.0023, Aligned region: 221..237
AAA_23 [PF13476], Evalue: 0.0023, Aligned region: 460..500
AAA_23 [PF13476], Evalue: 0.0023, Aligned region: 595..696
RNA_helicase [PF00910], Evalue: 0.0085, Aligned region: 222..242
RNA_helicase [PF00910], Evalue: 0.0085, Aligned region: 598..619
RNA_helicase [PF00910], Evalue: 0.0085, Aligned region: 698..716
Protein Sequence: 861 a.a.     [Download]
>gi|339487744|ref|YP_004702272.1| unnamed protein product [Pseudomonas putida S16]
MNLKSLFAKLNETSRTATESAAALCLSEHHYDVEVEHLLLQLLDNSDSDLAPILRHYEVVAERLQAQLVT
ALGTFKKGNTRTPALSPHITRMIEQAWLLASIEYGVGQVRSAHLLQALLDDAELRRVVIASAPELEKINA
DDLRLNLAALVEGSAESRQASPAAPVNSATKAGGKTPALDQYTVNLTQSAREGRIDPVLGREFEVRQMVD
ILTRRRQNNPILTGEAGVGKTAVVEGLALRIAQGDVPAVLKDVALHTLDLGLLQAGAGVKGEFENRLKAV
IEEVKRSLHPIILFIDEAHTLIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKDAALARR
FQVVKVEEPDEDKAIHMLRGLLGKMREHHKVAVMDEALVQAVRLSNRYITGRQLPDKAVSVLDTACARIA
LAQSSQPGALEDCRRQIDNLQAEIAVLGHEAGKGHDHTRRLGELQAALQAEQQREQQLNTQWQQELELVE
QLKALDAASEADAKQLNALRAELARVQGDQPLVHALVDSGAIAQVISGWTGIPLGKMLRDEIDTVQRLPA
LLGERVLGQDHALHEIGKRIKISRARMEDPNKPIGVFLLLGPSGVGKTETALALADTLYGGERNLITINM
SEYQEAHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGVLDDGEG
REINFRNTVIILTSNTGTERIMQTCLNATELPTPAAIVEDLREQLNHVFKPAFLGRLSIVPFYPVQDQIL
ERIVALKLERIAKRFARNHQAELSYDQALVKAIAARCTEVDSGARNIDNILSQTLMPELAQRVLERMAQD
TPIQRLAIELGSDGDFAYRVA
 
Nucleotide Sequence: 2586 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3158956-3161541 Pseudomonas putida S16 chromosome, complete genome
GTGAACCTGAAGTCTCTGTTCGCCAAGCTCAACGAAACCAGCCGCACGGCCACGGAAAGCGCGGCGGCCC
TGTGCCTGTCGGAGCACCATTACGACGTGGAGGTGGAGCACCTGTTGCTGCAGTTGCTCGACAACAGCGA
CAGCGACCTGGCGCCGATCCTGCGCCACTACGAAGTAGTCGCCGAGCGCCTGCAGGCGCAGCTGGTCACG
GCCCTGGGCACCTTCAAGAAAGGTAATACCCGCACCCCGGCGCTGTCGCCGCACATCACCCGCATGATCG
AGCAGGCCTGGCTGCTGGCGTCGATCGAATACGGCGTCGGCCAGGTGCGCAGCGCTCACCTGCTGCAGGC
CCTGCTCGATGATGCCGAACTGCGTCGCGTGGTGATCGCCTCGGCGCCGGAGCTGGAGAAAATCAACGCC
GATGACCTGCGCCTGAACCTTGCCGCGCTTGTAGAAGGCAGCGCCGAGTCCCGGCAGGCCAGCCCTGCGG
CGCCAGTGAACAGTGCGACCAAGGCCGGCGGCAAGACCCCGGCGTTGGACCAGTACACGGTCAACCTCAC
CCAGAGCGCCCGCGAAGGCCGCATCGACCCGGTGCTGGGCCGCGAGTTCGAAGTAAGGCAGATGGTCGAC
ATCCTCACCCGTCGCCGCCAGAACAACCCGATCCTCACCGGCGAAGCCGGGGTCGGCAAAACCGCCGTGG
TCGAAGGCCTGGCCCTGCGCATCGCCCAAGGTGACGTGCCGGCGGTGCTCAAGGATGTGGCCCTGCACAC
CCTCGACCTGGGCCTGCTGCAGGCCGGCGCCGGCGTCAAGGGCGAGTTCGAGAACCGCCTCAAGGCAGTG
ATCGAAGAGGTCAAACGCAGCCTGCACCCGATCATCCTGTTCATCGACGAAGCCCACACCCTGATCGGTT
CCGGTGGCCAGGCCGGGCAGAACGATGCCGCCAACCTGCTCAAGCCGGCCCTTGCCCGTGGCGAGCTGCG
CACCATCGCCGCCACTACCTGGGCCGAATACAAGAAGTACTTCGAGAAGGACGCCGCCCTCGCCCGCCGC
TTCCAGGTGGTCAAGGTGGAGGAACCCGACGAAGACAAGGCCATCCACATGCTGCGCGGCCTGCTCGGCA
AGATGCGCGAACACCACAAGGTAGCGGTGATGGACGAAGCGCTGGTGCAGGCCGTGCGCCTGTCCAACCG
CTACATCACCGGCCGCCAGCTGCCCGACAAGGCGGTCAGCGTGCTCGACACCGCCTGCGCACGCATTGCC
CTGGCGCAATCGTCGCAACCTGGCGCCCTGGAGGACTGCCGCCGCCAGATCGACAACCTGCAGGCCGAAA
TCGCCGTGCTCGGCCACGAAGCCGGCAAAGGCCACGACCACACTCGCCGCCTGGGCGAGCTGCAGGCTGC
CCTGCAGGCCGAGCAGCAGCGGGAGCAGCAGCTGAACACGCAGTGGCAACAGGAGCTGGAACTGGTCGAA
CAGCTCAAGGCGCTGGACGCCGCCAGCGAGGCCGATGCCAAGCAGCTCAACGCCCTGCGTGCCGAACTGG
CCCGCGTGCAAGGCGACCAGCCCCTGGTCCATGCCCTGGTCGACAGCGGCGCCATCGCCCAGGTCATCAG
CGGCTGGACCGGTATCCCGCTGGGCAAGATGCTGCGTGACGAGATCGACACCGTGCAGCGCCTGCCGGCC
CTGCTTGGTGAGCGCGTGCTGGGCCAGGACCACGCCCTGCACGAGATCGGCAAGCGCATCAAGATTTCCC
GCGCACGCATGGAAGACCCGAACAAACCGATCGGTGTGTTCCTGCTGCTCGGCCCCAGCGGCGTCGGCAA
GACCGAAACCGCGCTGGCCCTGGCCGATACCCTGTACGGCGGTGAACGCAACCTCATCACCATCAACATG
TCCGAGTACCAGGAAGCCCACACCGTTTCGAGCCTCAAGGGCTCGCCTCCCGGCTATGTCGGCTATGGCG
AAGGCGGCGTGCTGACCGAGGCGGTGCGCCGCAAGCCGTACAGCGTGGTGTTGCTCGACGAGGTGGAAAA
AGCCCACCCCGACGTGCTCGAACTGTTCTTCCAGGTATTCGACAAGGGCGTGCTGGACGATGGCGAAGGC
CGCGAGATCAATTTCCGCAACACGGTGATCATCCTCACCTCCAATACCGGTACCGAGCGCATCATGCAGA
CCTGCCTGAACGCCACCGAGCTACCGACGCCCGCAGCGATCGTCGAAGACCTGCGTGAGCAGCTCAACCA
TGTGTTCAAGCCGGCCTTCCTCGGCCGCCTGAGCATCGTGCCGTTCTACCCGGTGCAGGACCAGATCCTC
GAGCGCATCGTCGCCCTCAAGCTCGAACGCATCGCCAAGCGCTTCGCCCGCAACCACCAGGCCGAGCTCA
GCTACGACCAGGCGTTGGTCAAGGCCATCGCCGCGCGCTGCACCGAGGTCGACAGCGGTGCGCGCAACAT
CGACAACATCCTGTCCCAGACCCTGATGCCCGAGCTCGCCCAGCGCGTGCTCGAGCGCATGGCCCAGGAC
ACGCCGATCCAGCGTCTTGCGATCGAGCTGGGCAGCGATGGCGATTTCGCCTATCGCGTGGCCTGA
 Primer design