SecReT6
Protein ID: 339487745
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2842
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3161566..3162288 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDF8FXM9
KEGG IDppt:PPS_2842
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-34, Aligned region: 18..172
Protein Sequence: 240 a.a.     [Download]
>gi|339487745|ref|YP_004702273.1| unnamed protein product [Pseudomonas putida S16]
MQHKHTALKRLTTAALLVALAGCGVTDRIGKRMEDSWAADMLADSEKVILTSDGGNQLNPDAEGKPLSVV
MRVYQLTDLERFAATDAETLWDTPEKALGNTLVEAREITLLPGIGQIDQWPLAKSARYVGVAAFFRNEQD
ARWKVAFDANSLRKDGIWFSSDGLRVLVDNTEISAMRGVDVLNKPPTADQLAAAQKARDNAPTLTDKVQD
AVLDKASDAAGKSAQNTMDSTFNSLVDSVK
 
Nucleotide Sequence: 723 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3161566-3162288 Pseudomonas putida S16 chromosome, complete genome
ATGCAACACAAGCACACCGCCCTCAAACGCCTGACCACAGCTGCCTTGCTGGTGGCGCTGGCCGGCTGCG
GGGTCACCGACCGTATCGGCAAGCGCATGGAAGACAGCTGGGCGGCCGACATGCTGGCCGACAGCGAAAA
GGTCATCCTGACCTCCGACGGCGGCAACCAGCTCAACCCCGATGCCGAGGGCAAGCCGCTGTCGGTGGTG
ATGCGCGTGTACCAGCTGACCGACCTCGAACGCTTCGCCGCGACCGATGCCGAGACCCTGTGGGACACCC
CGGAAAAGGCCTTGGGCAACACCCTGGTGGAAGCCCGCGAGATCACCCTGCTGCCGGGCATCGGCCAGAT
CGACCAGTGGCCACTGGCCAAGAGCGCTCGCTACGTCGGCGTGGCAGCGTTCTTCCGCAACGAACAGGAC
GCGCGCTGGAAGGTCGCCTTCGACGCCAACTCGCTGCGCAAGGACGGTATCTGGTTCTCTTCCGACGGCC
TGCGGGTGCTGGTGGACAACACCGAAATCAGCGCCATGCGTGGCGTCGACGTACTGAACAAACCGCCGAC
CGCCGACCAGCTGGCAGCCGCGCAGAAGGCCCGGGACAACGCACCGACGCTCACCGACAAGGTGCAGGAC
GCCGTGCTCGACAAGGCCAGCGATGCCGCCGGCAAATCGGCACAGAACACCATGGATTCAACCTTCAACT
CTTTAGTGGATAGCGTCAAATGA
 Primer design