SecReT6
Protein ID: 339487746
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2843
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3162285..3163628 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDF8FXN0
KEGG IDppt:PPS_2843
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-137, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|339487746|ref|YP_004702274.1| unnamed protein product [Pseudomonas putida S16]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRTTPFHWGVQVLQVDEDALANGSLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKDLLKANDLKVHAALKLPEPFGLNYVEDGQEHKAARRFRKQFDTLPDLNEG
ELENEITSLRLNVVLLVDGDSLDGYSHCPLARLTRNSMGGFNLDPHFVHPTLHLGSHETLAGIGKRLLGA
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLT
FTLDTQLSDIPEYDHHDPAASLVKLDEMIRVMLDNVVPNQCIVINLNQTKPSYWQGQLHDPRLTEADFYI
SVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGHVYER
MMNAQTICFYAPSAFTNLKLELMAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3162285-3163628 Pseudomonas putida S16 chromosome, complete genome
ATGAGCAAGCAGAGCCGGGTGATGTGGTCGGAAGGCATGTTCCTGCTGCCCCAGCACTTCCAGTACCAGG
ATGAGTTCCACCAGCACCAGCTGGCCGAGGCGACCTTGCGCACCACCCCATTCCATTGGGGTGTGCAGGT
ACTGCAGGTGGATGAGGACGCCCTGGCCAACGGTTCGCTGCAGCTCAAGCGCCTCAAGCTGGTGTTCCCT
GACGGCAGCCTTTACGACGCACCGCAGCACGACCCGTTGCCGGCTGCCCGCGACCTCAAGGACCTGCTCA
AGGCCAACGACCTCAAGGTTCATGCTGCCTTGAAGCTGCCCGAGCCATTCGGCCTGAACTATGTCGAGGA
CGGCCAGGAACACAAGGCCGCGCGGCGTTTCCGCAAGCAGTTCGATACCCTGCCCGACCTCAATGAAGGC
GAGCTGGAAAACGAAATCACCAGCCTGCGCCTGAACGTGGTGCTGCTGGTGGACGGTGACAGCCTGGACG
GCTACAGCCACTGCCCGCTGGCCAGGCTGACCCGCAACAGCATGGGCGGCTTCAATCTCGACCCGCATTT
CGTCCACCCCACTTTGCATCTGGGCAGCCACGAGACCCTGGCCGGTATCGGCAAGCGCCTGCTCGGCGCC
CTGCAGGCCAAGAGCAAGGCCCTGTCCGGCCGACGCCGCGAACGCGCAGACCAGATCGCCGAGTTCGGCT
CCAGCGACGTAACCCTGTTCTGGCTGCTGAACACCGTCAACCGCGCCCACCCGCAGCTGGCCCATCTGCT
GGCGCACCCGCGCCTGCACCCCGAGCGCCTGTACCTGTTCCTTGCCGACCTGGCGGGTGGCCTGCTGACG
TTCACCCTGGACACCCAGCTCAGCGACATCCCCGAATACGACCATCACGACCCGGCCGCGTCGCTGGTCA
AGCTCGACGAGATGATCCGGGTGATGCTCGACAACGTGGTGCCCAACCAGTGCATCGTCATCAACCTCAA
CCAGACCAAGCCGTCGTACTGGCAGGGCCAGTTGCACGATCCACGCCTGACCGAGGCCGACTTCTATATC
TCGGTCCATGCCGACATGCCTGGTGCCAGCCTGCTGGAGCTGGTACCGCGGGCATTCAAGGTCGGCTCGC
CGGAAGACATCGAGGTGGTGGTCAACAGCGCGATGCCCGGCGTCACGCTCAACCATGCCGCACGGCTGCC
CAACGCAATTCCGGTGCGCCTGGACAACCAGTACTTCGCCATCGAGCCGCATGGCCATGTCTACGAGCGA
ATGATGAATGCCCAGACCATCTGCTTCTACGCGCCCAGCGCCTTTACCAACCTCAAGCTTGAACTGATGG
CGGTGCTCAAATGA
 Primer design