SecReT6
Protein ID: 339487747
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2844
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3163625..3164341 [+]
Producthypothetical protein
NoteTssL
UniProt IDF8FXN1
KEGG IDppt:PPS_2844
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.70E-54, Aligned region: 19..221
Protein Sequence: 238 a.a.     [Download]
>gi|339487747|ref|YP_004702275.1| unnamed protein product [Pseudomonas putida S16]
MTEAVLQQGAVAAANDKPTLKDLVQDFISMALIVRRGRQVTSVPAFEASVERFFANLEREARAANYSAEQ
VKDTQYALCAFLDESVLRASDNQLRQHFELQPLQFRYFGVHLAGEGFFEKVDALRADVKQNIDVLEVYHL
CLALGFEGKFSLGQKDQLRYLANTLGQDIARYRKAPKALSPDWALPDQVSQMLRHEVPLWVYLALIALVC
VAVYLTLDWLLDKDVAALSEQIRQLFSA
 
Nucleotide Sequence: 717 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3163625-3164341 Pseudomonas putida S16 chromosome, complete genome
ATGACCGAAGCCGTATTGCAACAGGGCGCCGTCGCGGCAGCCAACGACAAACCGACGCTCAAGGACCTGG
TCCAGGACTTCATCAGCATGGCCCTGATCGTGCGGCGTGGTCGTCAGGTCACCTCGGTGCCGGCCTTCGA
AGCCAGCGTGGAACGCTTCTTCGCCAACCTGGAACGCGAAGCCCGCGCTGCCAACTACAGCGCCGAACAG
GTCAAGGACACCCAGTACGCGCTGTGTGCCTTCCTCGACGAGAGCGTGCTGCGCGCGAGCGACAACCAGC
TGCGCCAGCACTTCGAGCTGCAGCCGCTGCAGTTCCGCTACTTCGGCGTGCACCTGGCGGGTGAAGGCTT
CTTCGAGAAGGTCGATGCGCTGCGTGCCGACGTCAAGCAGAACATCGATGTACTCGAGGTCTACCACCTG
TGCCTGGCCTTGGGCTTCGAGGGCAAGTTCAGCCTCGGCCAGAAAGACCAGCTGCGCTACCTGGCCAATA
CCCTGGGCCAGGATATTGCCCGCTACCGCAAGGCGCCCAAAGCACTGTCACCGGACTGGGCACTGCCCGA
CCAGGTGTCGCAGATGCTGCGCCACGAGGTGCCGCTGTGGGTTTACCTGGCGCTGATCGCGCTGGTCTGC
GTCGCCGTGTACCTGACGCTGGACTGGTTGCTGGACAAGGACGTCGCCGCCCTTTCCGAACAAATCCGCC
AGCTGTTCAGTGCCTGA
 Primer design