SecReT6
Protein ID: 339487748
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2845
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3164372..3168175 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDF8FXN2
KEGG IDppt:PPS_2845
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.00E-60, Aligned region: 181..435
IcmF-related [PF06761], Evalue: 2.00E-45, Aligned region: 491..555
IcmF-related [PF06761], Evalue: 2.00E-45, Aligned region: 635..878
DUF1215 [PF06744], Evalue: 4.00E-23, Aligned region: 317..343
DUF1215 [PF06744], Evalue: 4.00E-23, Aligned region: 780..821
DUF1215 [PF06744], Evalue: 4.00E-23, Aligned region: 1011..1126
AAA_16 [PF13191], Evalue: 0.00031, Aligned region: 112..258
AAA_16 [PF13191], Evalue: 0.00031, Aligned region: 460..475
AAA_16 [PF13191], Evalue: 0.00031, Aligned region: 870..939
Protein Sequence: 1267 a.a.     [Download]
>gi|339487748|ref|YP_004702276.1| unnamed protein product [Pseudomonas putida S16]
MKTLLRLLKNFWFLLLLLWLASLLTCWLVAPLLPWLQQHLPEALAIISACFLLVIVLRQYQRIRAEHNLE
NLLQIEVDRSWNATGEFRDQQVLRERLKHAIAMLRTDRSAGGGGKAALSDLPWYLVVGMSAAGKTSLLTH
SGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRDDQSASEFSAFLRMLRKQRGKAAINGLVMVV
SLPELLAANSDERNALAAQLVARVEEYAECLDANPPVYLMLSKTDQLPGFSQAFDGLDLHERQQPLGMTF
GLSEIRNNGLHAVLQTRLGNLQNHIRQHVDAQVIALGAEADSTLLNFPQYFAALSGVLEQFLEHFTRGHR
GGAPLLLRGLYFTSALQTGQQLGQVYEDVIADEFALQAAYDEHAENVGKAAGNRSYFITDTFRQVIFPDR
DLTLYQSRLGRQAAFSPLLLGLAAATGLLFIGWQALSFTNNRQWLDSLRGQLAQIEQAEDREQQLAAGKG
LEVLREQMARVENHRLQGVPLQLGGGLYHGEAIHQVTRTAYLAQLRSQALEPIARSLQVQMRAFNTFANG
INQELEFTPAPTPKKRNGKPLAPAIAAKAQAALGNSRAGAYAAKVNLATASDAAELSATTGGLSLSEEML
GRLDEQQVASIIDAYNTLKLYLLLTEPQGHPDPAFVAANLPQAWTNAATEGTPADAAVIAENAPLYVQLL
EQGQAPSLPRNEQLINETRQNLKSFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRALLYGSAGV
PAIYTRQGWDTFVKPELIKLVSGNLRNESDWVLDGEGGDAIVQKANFVREFMTRYKRDYTQAWYKMVSSV
GVRHFADLASATQQLGLLSDVQNSPVKNLLAAVNDNTQWDLPAKHAIPALGSTREDGFWSKVSGLFDDKD
ALPANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALRKLKVRMNNIQRSQDVGKSSK
QLISETLEGQPSEVTTVRNYVESSVDTSQDGLSRSLQGLFSLPIQYAWATLRDPAGQQIAKAWAQQIAKP
WEQVMAHRYPIAGSSRNEASVKDLQRFVDPDSGLLPAFKRNEIGNLAGGEGLGVGDGKAPALVNPGMLNS
IDKASSVGQVIASLSDRDNGFEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPGTSNAPGARLDV
VTLSGARVTVFDFPGRWGLLRMNESARVEDLDGIQQRFSWNTASGRVSLVVRNFGGVKLTDLGDVKALSA
LNDRGAQ
 
Nucleotide Sequence: 3804 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3164372-3168175 Pseudomonas putida S16 chromosome, complete genome
ATGAAAACATTATTGCGCCTTTTGAAGAATTTCTGGTTTCTCCTGCTGCTGCTGTGGCTGGCGAGCCTGT
TGACCTGCTGGTTGGTCGCCCCGTTGCTGCCATGGCTGCAACAGCACCTGCCCGAAGCACTGGCAATCAT
CAGCGCCTGCTTCCTGCTGGTGATCGTGCTGCGCCAATACCAGCGCATTCGCGCCGAGCACAACCTGGAG
AACCTGCTGCAGATCGAGGTTGATCGCTCGTGGAATGCCACTGGCGAGTTCCGTGACCAGCAGGTGCTGC
GCGAACGCCTCAAGCATGCCATTGCCATGTTGCGCACCGACCGCTCCGCTGGAGGCGGTGGCAAGGCGGC
ACTGTCCGATTTGCCCTGGTACCTGGTGGTTGGCATGTCGGCAGCCGGCAAGACCTCGCTGCTGACCCAT
TCCGGCCTGTCGGCCAGCATTGCCACGGCCAACGACAGCGAAAGCGGCACCCAGCACTGCGACTGGTACT
TCAGCCCCGACGCGGTAATGATCGACACCGCCGGCCGCTATTTGCGTGATGACCAGTCGGCCAGCGAGTT
CTCGGCCTTCCTGCGCATGCTGCGCAAGCAGCGCGGCAAGGCAGCGATCAATGGCCTGGTAATGGTGGTC
AGCCTGCCCGAGCTGCTGGCGGCCAACAGCGACGAACGCAATGCCCTGGCGGCCCAGCTGGTGGCGCGGG
TGGAAGAGTATGCCGAGTGCCTCGACGCCAACCCGCCGGTCTACCTGATGCTGAGCAAGACCGACCAGTT
GCCGGGCTTCAGCCAGGCGTTCGACGGCCTCGATCTGCATGAACGCCAGCAACCGCTGGGCATGACCTTC
GGCCTGTCGGAAATCCGCAACAACGGCCTGCACGCCGTGCTGCAGACGCGCCTGGGCAACCTGCAGAACC
ACATTCGCCAGCATGTCGACGCGCAGGTGATCGCCCTCGGTGCCGAAGCCGACAGCACCCTGTTGAACTT
CCCGCAATACTTCGCCGCACTCAGCGGTGTCCTCGAGCAGTTCCTGGAGCACTTCACCCGCGGCCATCGC
GGCGGTGCCCCGCTGCTGCTGCGCGGCTTGTACTTCACCAGTGCCCTGCAGACCGGGCAGCAGCTGGGCC
AGGTATACGAAGACGTCATCGCCGACGAATTCGCCCTGCAAGCCGCCTACGATGAGCACGCCGAGAACGT
CGGCAAGGCCGCGGGCAACCGCAGCTACTTCATCACCGACACCTTCCGCCAGGTGATATTCCCCGATCGC
GACCTGACCCTGTACCAGTCGCGCCTGGGCCGCCAGGCTGCGTTCAGCCCGCTGCTGCTGGGCCTGGCCG
CCGCCACCGGGTTGCTGTTCATCGGTTGGCAGGCACTGTCGTTCACCAATAACCGCCAATGGCTGGACAG
CCTGCGCGGGCAGCTGGCGCAGATCGAGCAGGCAGAAGACCGCGAGCAGCAGCTGGCCGCTGGCAAGGGC
CTGGAAGTGCTGCGCGAACAGATGGCCCGCGTCGAAAACCATCGCCTGCAGGGTGTACCACTGCAGTTGG
GGGGTGGCCTGTACCATGGCGAAGCCATCCACCAGGTGACTCGCACCGCCTACCTGGCGCAACTGCGCAG
CCAGGCGCTGGAGCCGATCGCACGCAGCCTGCAAGTGCAGATGCGGGCCTTCAACACCTTCGCCAACGGT
ATCAACCAGGAGCTGGAATTCACCCCGGCCCCGACACCGAAAAAACGCAATGGCAAGCCGCTGGCCCCGG
CCATTGCAGCCAAGGCCCAGGCTGCGCTGGGCAACAGCCGCGCCGGTGCCTATGCCGCCAAGGTCAACCT
GGCCACCGCCAGCGATGCCGCCGAGCTGTCTGCCACCACCGGTGGCCTGTCACTGTCCGAAGAAATGCTC
GGGCGCCTCGACGAACAGCAGGTGGCCTCGATCATCGATGCCTACAACACCCTCAAGCTGTACCTGTTGC
TGACCGAGCCCCAAGGCCATCCGGACCCGGCCTTCGTCGCTGCCAACCTGCCCCAGGCCTGGACCAACGC
CGCCACCGAAGGCACTCCGGCCGACGCAGCCGTGATCGCAGAAAATGCCCCGCTGTACGTACAGTTGCTG
GAACAAGGCCAGGCGCCGTCGTTGCCGCGTAACGAACAGCTGATCAACGAAACCCGGCAAAACCTCAAGT
CGTTCATGATCTCCAGCTCGCTGGTCGATCGCGAGTACCTGCGCCTGCAACTCGAGTCGAGCCGCCAGTT
CCCGGCCCTGAGCCTGAACGACCTGGTGCCGCAACCGGGCCGCGCGTTGCTGTATGGCTCTGCTGGCGTA
CCGGCAATCTATACCCGCCAGGGCTGGGATACCTTCGTCAAGCCGGAACTGATCAAGCTGGTGTCGGGCA
ACCTGCGCAACGAGTCGGACTGGGTGCTGGACGGTGAAGGTGGCGATGCCATCGTGCAAAAGGCCAACTT
CGTGCGCGAGTTCATGACCCGCTACAAACGCGACTACACCCAGGCCTGGTACAAGATGGTCAGCAGCGTG
GGGGTACGCCACTTCGCCGACCTGGCCTCGGCCACCCAGCAGCTGGGGCTGCTCAGCGATGTGCAGAACT
CGCCGGTAAAGAACCTGCTGGCTGCGGTCAATGACAACACCCAGTGGGACCTGCCGGCCAAGCACGCTAT
CCCGGCCCTCGGTAGTACCCGCGAAGACGGCTTCTGGAGCAAGGTCTCCGGCCTGTTCGACGACAAGGAC
GCCCTGCCCGCCAACGTCGCCCCGGCCCTGCCGGCGGTGGACGACGGCAGCCTGGCCAAGCGCTTCGAAC
CGGTGGCGCGAGTATTTGCCGAAAACAACGCCGAAGGCGCCGACAGCACCATCATGGACCGCTACCTGGC
CGCCTTGCGCAAGCTCAAGGTGCGCATGAACAACATCCAGCGTTCGCAGGATGTGGGCAAGAGCAGCAAG
CAGCTGATCAGCGAGACCCTGGAAGGCCAGCCGAGCGAAGTCACCACCGTACGCAACTATGTGGAAAGCA
GCGTCGACACCAGCCAGGACGGCCTGTCGCGCTCGCTGCAGGGGCTGTTCAGCCTGCCTATCCAGTATGC
CTGGGCGACCCTGCGCGACCCGGCCGGCCAGCAGATCGCCAAGGCCTGGGCGCAGCAGATCGCCAAGCCT
TGGGAACAGGTCATGGCGCACCGCTACCCGATTGCCGGCAGCAGCCGCAACGAGGCGTCGGTAAAGGACC
TGCAGCGCTTCGTCGACCCCGACAGCGGCCTGCTGCCGGCCTTCAAGCGCAACGAAATCGGCAACCTGGC
CGGGGGTGAAGGCCTGGGTGTGGGCGACGGCAAGGCACCGGCGCTGGTCAACCCAGGCATGCTCAACAGC
ATCGACAAGGCCAGCTCCGTGGGCCAGGTGATCGCCAGCCTGTCGGACCGTGACAACGGCTTCGAAATCA
TGCTGGAACCTTCTGCCAACTTCACCGACATCGTGTTCACCCTCGATGGCCAGGAACAGCACTACCGCAA
CGGCCGCAGTAGCTGGAACCGCTTCGCCTGGCCGGGCACCAGCAACGCTCCGGGTGCCCGCCTGGATGTG
GTCACCCTCAGTGGCGCGCGGGTCACCGTGTTCGACTTCCCCGGGCGCTGGGGCCTGCTGCGCATGAACG
AAAGCGCCCGGGTCGAGGACCTGGACGGCATTCAGCAACGCTTCAGCTGGAACACCGCCAGCGGCCGCGT
GAGCCTTGTAGTGCGTAACTTCGGTGGGGTGAAACTGACCGACCTGGGTGATGTCAAGGCGCTGAGCGCC
CTCAACGACAGGGGCGCCCAATGA
 Primer design

Protein ID: 339487750
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2847
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3169077..3171572 [+]
ProductOmpA/MotB domain-containing protein
NoteTssM
UniProt IDF8FXN4
KEGG IDppt:PPS_2847
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.00E-67, Aligned region: 83..112
ImcF-related_N [PF14331], Evalue: 2.00E-67, Aligned region: 189..453
OmpA [PF00691], Evalue: 9.20E-16, Aligned region: 716..811
IcmF-related [PF06761], Evalue: 2.70E-08, Aligned region: 95..132
IcmF-related [PF06761], Evalue: 2.70E-08, Aligned region: 323..334
IcmF-related [PF06761], Evalue: 2.70E-08, Aligned region: 507..640
Protein Sequence: 831 a.a.     [Download]
>gi|339487750|ref|YP_004702278.1| unnamed protein product [Pseudomonas putida S16]
MNKIKYYCLRYQPYLLGVAFFLAIFLVWAIGCALGFASLHSLLAGIGVFLLLSAGYVLLLYRGAGQHHNL
EGLLRDDADQAVLNATPADREEVSLLRERLLQSIERLRSNTPRGTSAKDALYALPWYLVIGQPAAGKSTM
ILQSGLNFPYAEREGARVAGLGGTRNCDWFFSSEAVLLDTAGRYMNSPEEAGKWRGFLQLLRQHRQRRPL
NGLIVSVSIADILHGSAEDQDRVAKRLRERIQESCALLEVRLPIYLVFTKCDLIPGFTPFYRQLDDAARG
EVMGKTFSHKGYEQADWGQRFGKAMDELTGYWQQVANQQLVQQDIQVTRQNNAAYRFPLELAALKPRLQQ
FVDSLLRANPYQNAEMLRGFYFTAALQADEALWGSHGQHVAERFALEHAEGTATAVSQPAPLFINSLFRK
VIIPDQHLVALYTSNTRERRRKAGWVAATGLAALVLCSLWGWSYLNNRAILANIAGELAQAKADDQAARG
QYAAWHSLDRLRFWAEHYYRQHREQGVPLGMRLGLYQGHEVEPLLRSRYFATLQNVMLKPTADNLTRTLY
LLTTIKVYQRNTRELQPVSGVDSVEAEALPHDNRAQSIADFGKAALDTYVMLSPARRENADPAFLKAHLP
DYWYPAIARHTGKSMAAAASEAGGNQNYLYASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQ
SLRSIETITLESDTLFAFGRADFQSLKSEGQRQLSAIASKLLNTPDIGKIIISGHADQLGDSQGNLQVSK
QRAQTIRTYLVGKGVPAELVVAQGEGSRKPLVNCDLQQPRAQLIKCLEPNRRVEIEVRGLN
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3169077-3171572 Pseudomonas putida S16 chromosome, complete genome
ATGAACAAGATCAAGTACTACTGCCTGCGCTACCAACCCTACCTGCTGGGAGTGGCGTTCTTCCTGGCGA
TCTTCCTGGTCTGGGCCATCGGCTGCGCCCTGGGCTTCGCCTCGCTGCATAGCCTGCTGGCCGGTATCGG
CGTGTTTCTGCTGCTGTCGGCAGGCTATGTACTGCTGCTTTATCGCGGCGCCGGCCAGCACCACAACCTC
GAAGGGTTACTGCGCGACGATGCCGACCAGGCGGTACTCAACGCCACCCCCGCCGACCGCGAAGAAGTAA
GCCTGCTGCGCGAACGCCTGCTGCAGAGCATCGAGCGCCTGCGCAGTAACACACCTCGCGGCACCTCGGC
CAAGGACGCGCTGTACGCCCTGCCCTGGTACCTGGTGATCGGTCAGCCGGCTGCCGGCAAGAGCACGATG
ATCCTGCAGTCGGGCCTGAACTTCCCCTATGCCGAACGCGAAGGCGCACGGGTTGCGGGGCTTGGCGGCA
CGCGCAACTGCGACTGGTTCTTCAGCTCCGAAGCCGTGCTGCTGGATACCGCCGGGCGCTACATGAACAG
CCCCGAAGAAGCCGGCAAGTGGCGCGGCTTCCTGCAGCTGTTGCGCCAGCATCGCCAACGCCGCCCTCTC
AACGGCTTGATCGTCAGCGTCAGCATCGCCGACATCCTGCATGGCTCGGCCGAGGACCAGGACCGCGTGG
CCAAGCGCCTGCGTGAACGGATCCAGGAAAGCTGCGCGCTGCTGGAAGTGCGCCTGCCGATCTACCTGGT
GTTCACCAAGTGCGACCTGATTCCCGGCTTCACCCCGTTCTATCGCCAGCTTGACGACGCCGCGCGTGGC
GAGGTGATGGGCAAGACCTTCTCGCACAAGGGTTACGAACAGGCCGACTGGGGCCAGCGTTTCGGCAAGG
CGATGGACGAGCTGACCGGTTACTGGCAGCAGGTGGCGAACCAGCAACTGGTGCAGCAAGATATTCAGGT
AACCCGGCAGAACAATGCGGCCTATCGCTTCCCGCTGGAGCTGGCCGCACTCAAGCCGCGCCTGCAACAA
TTCGTCGACAGCCTGCTGCGCGCCAACCCGTACCAGAACGCCGAAATGCTGCGCGGTTTCTATTTCACTG
CCGCACTGCAGGCCGATGAAGCCCTGTGGGGCAGCCACGGCCAGCATGTGGCCGAACGCTTCGCCCTCGA
ACATGCCGAAGGCACCGCCACTGCCGTCAGCCAGCCGGCGCCGCTGTTCATCAACAGCCTGTTCCGCAAG
GTGATCATCCCCGACCAGCACCTGGTGGCGCTGTACACCAGCAACACGCGGGAGCGCCGGCGCAAGGCGG
GCTGGGTTGCCGCCACCGGCCTGGCAGCCCTGGTGCTGTGCAGCCTGTGGGGCTGGTCGTACCTGAACAA
CCGCGCCATCCTGGCCAACATCGCCGGCGAACTGGCCCAGGCCAAGGCCGACGACCAGGCTGCCCGCGGC
CAGTACGCCGCCTGGCATAGCCTTGATCGCTTGCGCTTCTGGGCCGAGCACTACTATCGGCAGCACCGCG
AACAGGGCGTGCCGCTGGGCATGCGCCTGGGCCTGTACCAGGGCCATGAGGTCGAGCCGCTGCTGCGCAG
CCGTTACTTCGCCACGCTGCAGAACGTGATGCTCAAGCCCACGGCAGACAACCTGACCCGCACCCTGTAC
CTGCTGACCACGATCAAGGTGTACCAGCGCAACACCCGCGAACTGCAGCCTGTGAGCGGCGTGGACAGCG
TCGAGGCCGAGGCGCTGCCACATGACAACCGCGCGCAGTCGATCGCCGACTTCGGCAAGGCGGCGCTGGA
TACCTACGTGATGCTCTCGCCGGCCCGACGCGAAAACGCCGACCCGGCGTTTCTCAAGGCGCACCTGCCC
GACTACTGGTACCCGGCCATCGCTCGCCATACCGGCAAGAGCATGGCCGCGGCCGCCAGCGAGGCTGGCG
GCAACCAGAACTATCTGTACGCCAGCCGCCAGATCACCTTCTACAGCGACCAGATTCGTGAGCCGGATGT
GCCGCGTATCCTCGACAACGCCTTCCTGATGTCCAGTTCGCGCAATTACATCGACAGCCTGCGCGCCCAG
TCGCTGCGTTCGATCGAGACCATCACGCTGGAGTCCGACACCCTGTTCGCTTTCGGCCGGGCCGACTTCC
AGAGCCTGAAGAGCGAGGGCCAGCGCCAGCTGAGCGCAATCGCCAGCAAACTGCTGAACACGCCCGACAT
CGGCAAGATCATCATTTCCGGCCACGCCGACCAGCTCGGCGACAGCCAAGGCAACCTGCAGGTTTCGAAA
CAGCGGGCGCAGACCATTCGCACCTACCTGGTCGGCAAGGGCGTACCTGCCGAACTGGTGGTCGCCCAGG
GCGAAGGCAGCCGCAAGCCGCTGGTCAACTGCGACCTGCAGCAACCGCGAGCGCAACTGATCAAGTGCCT
GGAGCCCAACCGCCGGGTGGAAATCGAAGTACGCGGGCTCAACTGA
 Primer design