SecReT6
Protein ID: 339487751
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2848
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3171716..3172234 [+]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDF8FXN5
KEGG IDppt:PPS_2848
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.20E-41, Aligned region: 6..146
Protein Sequence: 172 a.a.     [Download]
>gi|339487751|ref|YP_004702279.1| unnamed protein product [Pseudomonas putida S16]
MAFDAYIQIDGIPGEVLDAKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRKAVDKASAK
LFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVRFIAGGNQNGEDKAVSDLPVEEISFNFAR
IKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3171716-3172234 Pseudomonas putida S16 chromosome, complete genome
ATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCGGGCGAAGTACTGGATGCAAAGCACAAGGACT
GGATCGAAGTGCTGGGCTACGAGTACGGCGCCACCCAGGCCACCTCGGCTACCGCCAGCTCCTCGGGCGG
TGCGTCGTCCGAGCGTGTTGCCCTGAGCGACTTCAAGATCCGCAAGGCGGTCGACAAGGCTTCGGCCAAG
CTGTTCGAACACTGCTGCACCGGCAAGCACATCGCCAAGCTGAAGCTGAACGTGAACCGCGCCGGTGGTG
ACAAGGTCACCTACCTGACCATCGACATGGAAGAAGTCGTGGTGTCCTCGGTGCGCTTCATCGCCGGTGG
CAACCAGAACGGTGAAGACAAGGCTGTGAGCGACCTGCCGGTCGAAGAAATCAGCTTCAACTTCGCCCGC
ATCAAGACCACCTACACCCAGCAGAACCGCACCGACGGCCAGGCTGGCGGCAACATCGTCGGCGGCTGGG
ACCGCACCGCGAACAAAGTGTTTGCCTGA
 Primer design