SecReT6
Protein ID: 339487752
SecReT6 ID451
T6SS typei4b
Gene symbol-
Locus tagPPS_2849
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T6SS(s) in this replicon]
Location [Strand]3172330..3173427 [+]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDF8FXN6
KEGG IDppt:PPS_2849
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-20, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 2.00E-20, Aligned region: 200..214
ImpA-rel_N [PF06812], Evalue: 2.00E-20, Aligned region: 241..257
Protein Sequence: 365 a.a.     [Download]
>gi|339487752|ref|YP_004702280.1| unnamed protein product [Pseudomonas putida S16]
MPEILNDLSLATLTAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWEQVVNLSAQGL
AQQSKDLMLVAWLSEGLAQREHFEGITFGLRLTEQVLEAFWDTLYPTLEDGLDERAARLSWLKTTLTDIA
GGLPITQGQNFGVLRYDESRYVENLALQNPKAMQTALNEGKINAEIFQRSVALSDTEHLRTKALQIAASL
EACKALQASADRLFGHEAPSFASLADMLSRASQLAEKLLKDRGVELHPATAAAAEPEATVAPTSEAGEPM
NTPVQATTPAPMRTTPLTRDEAFTMLAGIAQFFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDSNV
VDNIRDVLGTREPRS
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|339484941|ref|NC_015733.1|:3172330-3173427 Pseudomonas putida S16 chromosome, complete genome
ATGCCTGAAATCCTCAATGACCTTTCGCTGGCAACGCTGACCGCACCCATCGAGGGTGGCAGTGGCGAAG
ACTTGAGCTTCTCTGCCTTGTTCGACCAGATCAAGGAGGCACGCCGGGCAGACCCTGACTACCTGACCCA
GGGCGACTGGCAAACCGACCTGAAGACCGCCGACTGGGAGCAGGTGGTCAACCTGTCGGCCCAAGGGCTG
GCGCAGCAAAGCAAGGACCTGATGCTGGTAGCCTGGCTCAGCGAAGGGTTGGCCCAGCGTGAACATTTCG
AAGGCATCACCTTTGGCCTTCGGCTGACCGAACAGGTACTGGAAGCATTCTGGGACACGCTGTACCCAAC
ACTCGAAGATGGCCTGGACGAACGCGCTGCGCGGCTGTCCTGGCTGAAGACCACGCTCACCGACATTGCC
GGTGGCTTGCCCATTACCCAAGGGCAGAATTTTGGCGTGTTGCGCTATGACGAATCACGCTACGTAGAAA
ACCTTGCCTTGCAGAACCCCAAGGCAATGCAGACCGCGCTGAACGAAGGCAAGATCAACGCCGAAATCTT
CCAGCGCTCGGTGGCGCTCAGCGACACCGAACACCTGCGCACCAAGGCCCTGCAGATCGCCGCCAGCCTG
GAGGCCTGCAAAGCCCTGCAAGCCAGTGCCGACCGCCTGTTCGGCCATGAGGCGCCCAGCTTTGCCAGCC
TTGCCGACATGCTGTCGCGCGCCAGCCAGCTGGCTGAAAAACTGCTCAAGGACCGCGGCGTCGAACTGCA
CCCCGCCACTGCGGCAGCGGCAGAGCCCGAAGCCACTGTTGCTCCCACCAGCGAAGCAGGTGAACCGATG
AACACACCCGTCCAGGCCACCACGCCTGCGCCGATGCGCACGACGCCACTGACCCGCGACGAAGCCTTCA
CCATGCTTGCGGGTATCGCCCAGTTCTTCAAGCAGAGCGAACCGCAAAGCCCGGTGCCCTACCTGATCGA
ACGCGCCATCAAGTGGGGCAACATGCCGCTGGAAGGCTGGCTGAGCGATGTGATCAAGGACAGCAACGTG
GTGGACAACATTCGCGACGTGCTGGGCACCCGCGAGCCAAGATCCTGA
 Primer design