SecReT6
Protein ID: 339496163
SecReT6 ID453
T6SS typei1
Gene symbol-
Locus tagPSTAB_4086
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T6SS(s) in this replicon]
Location [Strand]4412978..4414486 [+]
ProductFis family transcriptional regulator
NoteSfa2
UniProt IDF8H6P3
KEGG IDpsz:PSTAB_4086
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 9.30E-71, Aligned region: 196..363
Sigma54_activ_2 [PF14532], Evalue: 8.70E-25, Aligned region: 197..367
HTH_8 [PF02954], Evalue: 1.90E-14, Aligned region: 455..495
AAA_5 [PF07728], Evalue: 1.40E-07, Aligned region: 219..338
GAF_3 [PF13492], Evalue: 3.00E-06, Aligned region: 28..150
GAF_2 [PF13185], Evalue: 4.20E-06, Aligned region: 26..174
GAF_2 [PF13185], Evalue: 4.20E-06, Aligned region: 259..280
HTH_30 [PF13556], Evalue: 8.40E-06, Aligned region: 451..465
HTH_30 [PF13556], Evalue: 8.40E-06, Aligned region: 469..495
HTH_28 [PF13518], Evalue: 0.0029, Aligned region: 469..492
AAA_2 [PF07724], Evalue: 0.0053, Aligned region: 218..318
Protein Sequence: 502 a.a.     [Download]
>gi|339496163|ref|YP_004716456.1| Fis family transcriptional regulator [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MFNQVPQPLRYAEALLGRFAGLARAANADSLLGGLVETAAQLSNCQLSQLYLLDATHTRLTLCAEWHNGL
LQPREATSLPSDYDGEQLLQYCLCQNQTLCLSELDSNLHASSFLPDSPKPWRSLLCLPLQDEQQRVAGLL
LTASTESRELHGFSGSLAQLGAFGLAQLHLLQRLRAPGGTAPVAAPVSPCASGYGLIGDSPRMRAVYQLI
GKVLHSPVNVLLTGETGTGKELVARAIHDCGFRRSKPFIVQNCASLPEQLLESELFGYRKGAFTGADRDR
SGLLDAANGGTLFLDEIGDMPLLLQAKLLRVLQEGEVRPLGSTETHKVDVRIVAATHRDLRSQVENGLFR
EDLFYRLSHFPIELPPLREREEDILRLARHFADKACAFLQRDLCRWSDAALERLAGYAFPGNVRELKGLV
ERAVLLCEGGELLPEHFNLHVEASLDSSLNLRERMERVERSLLMDCLRKNGGNQSQAARELGLPRRTLLY
RMERLNISPADL
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|339492077|ref|NC_015740.1|:4412978-4414486 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGTTCAATCAGGTGCCACAGCCGCTGCGCTATGCCGAGGCCCTGCTGGGCCGTTTCGCCGGGCTGGCGC
GCGCGGCGAACGCCGACAGCCTGCTCGGTGGACTGGTGGAAACCGCGGCGCAGCTGAGCAACTGCCAACT
CAGCCAGCTCTATTTGCTGGACGCCACCCACACTCGCCTGACGCTCTGCGCTGAATGGCACAACGGCCTG
CTACAGCCACGCGAAGCCACCAGCCTGCCGAGTGATTACGACGGCGAGCAGCTGCTGCAATACTGCCTGT
GCCAGAACCAGACCCTGTGCCTCAGCGAACTGGACAGCAATCTGCACGCTTCGAGCTTCCTGCCGGATAG
CCCAAAGCCGTGGCGCAGCCTGCTCTGCCTGCCGCTGCAGGACGAGCAACAGCGCGTCGCCGGCCTGCTG
CTGACGGCCAGTACCGAATCGCGCGAGCTGCACGGCTTCAGCGGCTCGCTGGCCCAGCTCGGCGCCTTCG
GCCTCGCCCAGCTGCATCTTCTCCAGCGCCTGCGCGCGCCCGGCGGCACCGCGCCAGTTGCCGCGCCAGT
CAGTCCCTGCGCCAGCGGTTACGGCCTCATCGGCGACAGCCCGCGCATGCGTGCGGTCTACCAATTGATC
GGCAAGGTGCTGCACAGCCCGGTCAACGTGCTGCTCACGGGAGAAACCGGTACCGGCAAGGAACTGGTGG
CGCGCGCCATTCACGATTGCGGGTTCCGACGCAGCAAACCCTTTATCGTGCAGAACTGCGCTTCGCTGCC
TGAGCAGCTTTTGGAAAGTGAGCTGTTCGGCTACCGCAAGGGCGCCTTCACCGGTGCCGACCGCGACCGC
AGCGGCCTGCTCGATGCGGCGAACGGCGGCACGCTGTTCCTCGACGAGATCGGTGACATGCCATTGCTGC
TGCAGGCCAAGCTGTTGCGCGTGCTGCAGGAAGGCGAAGTGCGCCCGCTGGGCTCCACCGAAACCCACAA
GGTCGACGTGCGCATCGTCGCCGCCACCCACCGTGACCTGCGCAGCCAGGTGGAGAACGGCCTGTTTCGC
GAGGATCTGTTCTACCGCCTCTCGCACTTCCCCATCGAACTGCCGCCGCTGCGCGAGCGTGAAGAGGACA
TCCTGCGCCTGGCCCGGCATTTCGCCGACAAGGCCTGCGCGTTTCTCCAGCGCGATCTGTGTCGCTGGTC
CGACGCCGCGCTCGAGCGTCTGGCAGGCTATGCCTTCCCCGGCAACGTGCGGGAGTTGAAGGGTCTGGTG
GAGCGCGCCGTGCTGCTCTGCGAGGGCGGTGAGCTGCTGCCGGAACACTTCAATCTGCATGTGGAAGCAA
GCCTGGACAGCAGCCTGAACCTGCGCGAACGCATGGAGCGGGTCGAACGCAGCCTGCTCATGGATTGCCT
GCGCAAGAACGGCGGCAACCAGAGCCAGGCCGCCCGCGAACTCGGCCTGCCGCGGCGAACGCTGCTGTAT
CGCATGGAACGGCTGAATATCAGCCCGGCCGATCTCTAA
 Primer design