SecReT6
Protein ID: 339999221
SecReT6 ID454
T6SS typei4a
Gene symbol-
Locus tagSBG_1234
StrainSalmonella bongori NCTC 12419
Repliconchromosome [GenBank: NC_015761] [Browse all T6SS(s) in this replicon]
Location [Strand]1351208..1354747 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDF8VIG0
KEGG IDsbg:SBG_1234
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.90E-23, Aligned region: 111..283
ImcF-related_N [PF14331], Evalue: 5.90E-23, Aligned region: 290..332
Protein Sequence: 1179 a.a.     [Download]
>gi|339999221|ref|YP_004730104.1| type VI secretion protein IcmF [Salmonella bongori NCTC 12419]
MTQPWLTLLIIVLVLLVVTLWCLWWQWEYRNNTFIRAQKEIQHACGGQDPYDSNRILMLGDEADNRLLCR
SWSLADGAEYWFGQWWYNQQCSLLCVPQTLQMPGKKRLIRQSDWQKLLAALVKSRPQRPLDAMIITLPLD
ALRGDDNKQAQLLNNCHQIQQACGLSLPVYLIVSGLEEIEGTQDLLTLLSDEAKRSPIGSAIPVAREAIW
KSVWIDDALANTRHTLRDVITALGTLHGHTSGTLFRLPEFFPTIATPLHDYFDTLLNSSARDEPPLLRGI
WFVARSAIADKPHMQFCQNLLEGKIIAESGLALPVRRLLRLNLRRHFITLACYSCAGILWLVAMIWSWHY
QHTNALVLHDRLQLLATQTARDSNSGERTATLYWRILNAVPQWQFRSIVWPGSLFSRTDNKLRETFQNAT
LASLLAPAANSVCLQDQTPRAGELSGEHDDLLPDERYRNITQLLAQTKQMEAHYLPLLQLMQVKQPTVQT
LAAISASVWGVNVDTDSLPSRTALNELFATLNINRLRLPEISDLTQRNSELFSRETMRWLEQHYGNTSLD
NNEEQLEQILTLFSNGTAVTPFFVRSLVRQISRLQSALATINNLSRDAAHSPIRLPLDDLLAQAHSLRLI
DNKVGQALLRHEALLRQRFLAQVDGSRLHFSSLTEQSPEGEFSVSPDILALQKSLRGLLNQPFWQRGTNQ
TQPNKSGYPGELQLQQALMLYNGYQRFIQQLPDSLWRPKLLSLAQNAVENAMLQALYADAPEAVQENNID
TLSAGQAIDALVQLNRPQRAVALRQQIAVQIIARIRREGSALLPANAPPAVNYMTPEQAQDSSQRMTSWA
NAQTEQISATLARYQQDIAWLDRQRPWLNSEDNQLIMRWTNSLGAMQRLQQQDPTSPPARMTALAAMIPT
LNAQNCQSELTPFTASGSNDFYSQSLNSLINASQQKCQQLRQHESAGTVQAISNLYNVWLAGHFPFTTLP
HAPDADVDRVRELTQLLATLPADSLAIQPPLIQQLAAAQPLLAALLSPDGVVVRVHWRTQRDKEAGADQI
VDWRLSGNQQSISYPGGTREDLHWRSGDNLSFSLRWATNSAWRPLPGSPQSVTVVDDTGRWRWQGAWSLL
RMISQQRPGGELALPLSLRFSLPTGNGQQRAQATVYFNVALLDAEGKAPLAWVPLSAKE
 
Nucleotide Sequence: 3540 bp     [Download]
>gi|339998036|ref|NC_015761.1|:c1354747-1351208 Salmonella bongori NCTC 12419, complete genome
GTGACGCAACCCTGGCTTACGCTTCTTATTATTGTGTTGGTGCTGTTGGTGGTGACCCTCTGGTGCCTCT
GGTGGCAATGGGAATACCGCAATAACACGTTTATCCGCGCACAAAAAGAGATCCAGCACGCCTGCGGCGG
CCAGGATCCCTACGATAGTAACCGAATCCTGATGCTGGGCGACGAGGCGGATAACCGCCTGCTGTGCCGC
AGCTGGTCGCTCGCCGATGGCGCAGAATACTGGTTCGGGCAGTGGTGGTATAACCAGCAGTGTTCACTGC
TTTGTGTGCCGCAAACTCTGCAAATGCCGGGCAAAAAGCGGCTCATCAGACAAAGCGACTGGCAAAAACT
GCTGGCGGCGCTGGTAAAAAGCCGCCCCCAGCGTCCTCTGGATGCGATGATTATCACTCTACCGCTTGAC
GCGTTGCGCGGTGATGACAATAAGCAGGCGCAACTGCTGAATAACTGCCATCAAATCCAGCAGGCATGTG
GCTTGAGCCTGCCAGTCTATCTGATAGTAAGCGGTCTGGAAGAGATCGAAGGCACTCAGGATTTACTGAC
GCTTTTGTCTGATGAGGCCAAACGTAGCCCGATAGGCAGCGCAATTCCGGTCGCCCGGGAGGCTATCTGG
AAGTCAGTATGGATTGACGACGCGCTGGCCAACACGCGCCATACCCTGCGCGATGTTATTACAGCGCTGG
GCACATTGCATGGACACACGTCAGGCACGCTTTTCAGACTGCCGGAGTTTTTCCCCACTATCGCCACCCC
CCTGCATGATTATTTTGATACCTTGCTCAATAGCAGCGCCAGGGACGAACCGCCGTTGCTACGCGGCATC
TGGTTTGTCGCCCGCAGCGCTATCGCCGATAAACCACACATGCAGTTTTGCCAGAATTTACTGGAGGGAA
AAATCATTGCCGAAAGCGGGCTGGCGCTCCCGGTTCGCCGTCTGCTGCGACTTAATCTGCGGCGCCATTT
TATTACGCTTGCCTGCTATAGTTGCGCGGGTATTCTCTGGCTGGTGGCGATGATCTGGAGCTGGCATTAC
CAGCATACCAATGCCCTGGTGCTACACGATCGCCTGCAATTACTCGCCACTCAAACCGCTCGCGACAGCA
ACTCTGGCGAACGTACCGCTACGCTCTACTGGCGTATTCTGAACGCGGTGCCACAGTGGCAGTTCCGCTC
CATCGTCTGGCCCGGTTCGCTGTTCAGCCGTACCGATAATAAACTGCGTGAAACATTCCAGAATGCAACG
CTGGCAAGCCTGTTGGCCCCTGCCGCCAATAGCGTCTGTCTGCAGGATCAAACTCCCCGCGCCGGCGAAC
TTTCGGGCGAGCATGACGATCTACTGCCTGATGAACGTTACCGGAACATCACCCAGCTTCTCGCCCAGAC
CAAACAGATGGAGGCCCATTACCTGCCCTTGCTCCAGCTTATGCAGGTAAAACAACCCACTGTCCAGACT
TTAGCGGCCATCTCCGCCAGCGTCTGGGGGGTTAATGTCGATACCGACTCGTTACCCTCACGGACCGCGC
TAAATGAACTGTTTGCCACTCTCAATATCAACCGTCTGCGCCTGCCGGAAATCAGCGATCTGACGCAGCG
CAATAGCGAGCTCTTTTCCCGGGAGACGATGCGCTGGCTGGAACAGCACTATGGCAACACCAGCCTTGAC
AACAATGAGGAGCAACTGGAGCAGATACTGACGTTGTTCAGTAACGGTACGGCGGTAACGCCGTTTTTTG
TCCGCTCGCTGGTGCGCCAGATCAGCCGTTTACAAAGTGCGCTGGCAACAATTAATAATCTCAGCCGCGA
TGCGGCGCATTCCCCTATCCGCCTACCGCTGGACGATCTGCTGGCGCAGGCTCACTCCCTGAGGCTTATT
GATAATAAGGTCGGCCAGGCGTTGCTACGCCATGAGGCGTTACTGCGACAGCGTTTTCTGGCGCAGGTTG
ACGGCTCGCGACTGCATTTTTCTTCGCTGACCGAACAGTCGCCGGAAGGCGAATTCAGCGTATCTCCAGA
TATTCTTGCGCTGCAAAAAAGTTTACGCGGCCTGCTTAACCAGCCCTTCTGGCAGCGTGGCACAAACCAG
ACGCAACCCAATAAATCCGGCTATCCGGGAGAATTACAGTTGCAGCAAGCATTAATGCTGTATAACGGCT
ACCAGCGTTTCATCCAGCAACTGCCGGACAGCCTGTGGCGGCCCAAATTACTGTCGCTGGCGCAGAATGC
GGTCGAAAATGCAATGTTACAGGCGCTCTATGCCGATGCGCCGGAAGCCGTGCAGGAGAACAACATCGAC
ACGTTAAGCGCGGGTCAGGCAATCGACGCCTTAGTTCAACTTAATCGCCCGCAGCGCGCAGTGGCGCTTC
GCCAGCAAATTGCGGTACAGATTATCGCCCGTATCCGCCGCGAGGGCAGCGCCCTATTGCCAGCCAACGC
GCCACCAGCCGTAAATTATATGACCCCGGAACAGGCACAGGATAGCAGTCAAAGGATGACAAGTTGGGCG
AATGCGCAGACGGAGCAAATTTCCGCCACGCTTGCCCGTTACCAGCAGGATATCGCGTGGCTTGACCGGC
AGCGGCCATGGCTTAACAGCGAAGACAACCAGCTTATTATGCGCTGGACAAACTCGCTTGGCGCGATGCA
ACGTCTGCAACAACAAGACCCGACCAGTCCGCCCGCGCGAATGACGGCGCTTGCCGCCATGATACCGACG
CTGAATGCGCAGAATTGTCAGAGCGAACTGACGCCGTTTACCGCCTCCGGCAGCAACGATTTTTACAGCC
AGTCGCTGAATTCGCTAATCAACGCCTCACAGCAAAAATGCCAGCAGTTACGCCAGCACGAGAGCGCCGG
TACGGTACAAGCCATTAGTAACCTCTATAACGTCTGGCTGGCAGGCCATTTTCCGTTTACCACCTTACCT
CACGCGCCAGACGCCGATGTTGATCGAGTGCGCGAACTCACGCAACTTCTCGCCACGCTGCCCGCGGACT
CCCTCGCCATTCAGCCGCCACTGATCCAGCAGTTGGCGGCTGCACAGCCGCTGCTCGCCGCGCTGCTCTC
CCCCGACGGCGTAGTCGTGCGCGTCCACTGGCGCACCCAACGTGATAAAGAAGCAGGAGCGGATCAGATA
GTCGACTGGCGTCTTAGCGGCAATCAGCAGTCGATAAGCTACCCTGGCGGCACGAGGGAAGATCTGCACT
GGCGAAGCGGCGATAATCTGAGCTTCAGCCTGCGCTGGGCAACTAATTCCGCCTGGCGGCCTTTACCAGG
TTCGCCGCAAAGCGTGACGGTGGTGGATGATACCGGACGCTGGCGCTGGCAGGGCGCGTGGTCGCTGTTG
CGAATGATAAGCCAACAGCGTCCTGGTGGCGAGTTAGCATTGCCATTATCTCTGCGCTTCAGCCTGCCTA
CCGGTAACGGCCAGCAGCGGGCCCAGGCCACCGTTTATTTCAACGTCGCGTTACTGGACGCGGAAGGGAA
AGCGCCGCTGGCGTGGGTACCGCTTAGCGCAAAAGAATAA
 Primer design