SecReT6
Protein ID: 340785255
SecReT6 ID455
T6SS typei4b
Gene symbol-
Locus tagCFU_0058
StrainCollimonas fungivorans Ter331
Repliconchromosome [GenBank: NC_015856] [Browse all T6SS(s) in this replicon]
Location [Strand]83424..87356 [+]
Productputative transmembrane protein
NoteTssM
UniProt IDG0A7Y6
KEGG IDcfu:CFU_0058
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.90E-70, Aligned region: 186..446
IcmF-related [PF06761], Evalue: 5.70E-48, Aligned region: 492..854
DUF1215 [PF06744], Evalue: 5.20E-28, Aligned region: 989..1104
O-antigen_lig [PF13425], Evalue: 1.40E-05, Aligned region: 7..92
O-antigen_lig [PF13425], Evalue: 1.40E-05, Aligned region: 428..520
Protein Sequence: 1310 a.a.     [Download]
>gi|340785255|ref|YP_004750720.1| putative transmembrane protein [Collimonas fungivorans Ter331]
MQRIWQFLTNTRTLAVVGFVALACFLFLAADALQIDGIWVVVFLVAILLVWGLVVLYRKQRTKTASKDFS
SMLEGQAEKGSDKPSVVGRDETETIRKRMLEAISTIKNSKLGEKSGATALYELPWYMIIGNPAAGKSTAV
ANSGLQFPLADKNSNIVQGVGGTRNCDWFFTTDGILLDTAGRYSVHEEDRAEWFSFLGLLKKHRSRAPIN
GIIIAVSVAELAGNRPEFGINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFVDMDRGEKDR
VWGATLPYSRKTSSQDVLAYFDERFDELFEGLKEISLANMALSRGDRLPPGVLTFPLEFAAVKSSLRAFI
ATLFEENPFQFKPVFRGFYFTSALQEGSGLSTSSERIAERFDLKLQPLERPEIHSKHGFFLLNLFRKVIF
ADKDLVSQYASRHKTRLRYTMFFAATAFVGLALAGWSWSYIGNRQLTANVQADLDKAIKLQEKRLDLQSR
FEAMEILQDRIEQLQKYDNHRPLSVGFGLYQGELLEQKLREEYFAGVKDIMLKPVTANIESFLSEMNAHA
GSLEPMSRPVQLVAGAAQPAAGAAAAASTAAAQAANAGSTQQYKDSSPTNVEDGYNALKTYLMLSDRSRA
ESSHLNDQLTRFWRGWLESNRGNMTREQMIRSAERLMSFYLSQVSDPSWPTIESKLTLVDQSRDNLRRVV
RGMAARDRVYADIKARASTRFPSITVASIVGDQDKELIVGSYAIPGTFTRDAWEKFVQGAFKEAANKELQ
SADWVLKTASSDDLTLEGSPEQIQKALVTQYKTEYAKEWQKFMQGANIADLGGFDNAVKAMNRFGDPSTS
PINKFVTAVYQQTSWDNPSLLNTGLGRAQSGFIAWFKQTILRQAPSGVNVNVNLNTSTDPTAAPMGPVGK
EFAGVARMVTAKDKDATLMRGYMESLSKLRTRFNQIKNQGDTGPGANQLMQQTLNGSGSELADALKYVDE
QMLVGMSDSQKQAIRPILVRPLIQAFAVTIKPTEAEMNRTWLAQVYSPFEKTLAEKYPFAANSKIEATSA
EIGQTFGPDGSIAKFVNSSMGPLVVRRGDTLAAKTWADMGITLSPTMVSSFARWVAPLGASSAAAGGSAG
GADAQTVFQIQALPAGGTTEYTIEIDGQQLRYRNTQAQWTNFVWPNPQGVAGARITAVTFDGRTVEIANQ
PGRFGLERLINTAVRKRKDGNFELSWTNENITVPINLKIISSPQVSAKSPDGGAQQGQGFRGMRLPETIV
GTAASPVSNPAAPAAGAAPAPAVSAAGTAPAGATAAAAPAAAATAGGAVQ
 
Nucleotide Sequence: 3933 bp     [Download]
>gi|340785197|ref|NC_015856.1|:83424-87356 Collimonas fungivorans Ter331 chromosome, complete genome
ATGCAAAGAATTTGGCAATTCCTGACGAATACACGAACCCTGGCGGTGGTCGGTTTTGTGGCGCTGGCCT
GCTTTCTCTTTCTCGCCGCGGACGCTTTGCAGATCGACGGCATCTGGGTGGTGGTTTTCCTGGTGGCGAT
CCTGCTGGTATGGGGCCTGGTGGTGCTGTACCGCAAACAGCGCACCAAGACGGCGTCGAAAGATTTCAGC
TCGATGCTGGAAGGCCAGGCCGAAAAGGGCAGCGATAAACCTAGTGTTGTCGGCCGCGACGAAACCGAAA
CCATCCGCAAGCGGATGCTGGAAGCGATTTCCACCATCAAGAATTCCAAGCTCGGCGAAAAATCCGGTGC
TACAGCTTTATATGAGCTGCCGTGGTACATGATCATCGGCAATCCGGCCGCCGGCAAAAGTACAGCAGTC
GCCAATTCCGGCCTGCAGTTCCCGCTGGCCGACAAGAACAGTAATATCGTGCAGGGCGTAGGCGGCACCC
GCAACTGCGACTGGTTCTTCACGACCGACGGCATCCTGCTCGATACCGCGGGACGCTATTCGGTGCATGA
AGAGGACCGCGCAGAGTGGTTCAGTTTCCTCGGCCTGCTGAAAAAGCATCGCAGCCGGGCGCCGATCAAC
GGCATCATCATCGCCGTCAGCGTGGCGGAACTGGCCGGCAACCGGCCCGAGTTCGGCATCAACCTGGCCA
AGAACCTGCGCCAGCGGGTGCAGGAACTGACTGAAAAGCTGGAAGTGTTTGCACCGGTCTACGTCATGTT
TACCAAGGCCGACCTGATCACCGGCTTCACCGAATTCTTTGTCGACATGGACCGCGGCGAAAAAGACCGG
GTCTGGGGCGCCACCTTGCCCTACAGCCGCAAGACCAGCAGCCAGGATGTGCTGGCGTATTTCGACGAAC
GCTTCGACGAGTTGTTCGAAGGCCTGAAAGAAATCAGCCTGGCCAACATGGCGCTGAGCCGGGGCGACCG
TCTGCCGCCCGGCGTGCTGACTTTCCCGCTCGAATTCGCCGCGGTAAAGAGCTCCTTGCGTGCCTTCATC
GCCACCCTGTTCGAAGAAAACCCGTTCCAGTTCAAGCCGGTATTCCGCGGTTTCTATTTCACCAGCGCCT
TGCAGGAAGGCAGCGGCCTCAGCACGTCGTCGGAACGGATCGCCGAGCGCTTCGATCTCAAGCTGCAACC
GCTGGAGCGTCCGGAAATCCATTCCAAGCACGGCTTCTTCCTGCTCAACCTGTTCCGCAAGGTCATCTTT
GCCGACAAGGACCTGGTCTCGCAATACGCCAGCCGCCACAAGACCCGCTTGCGCTACACCATGTTTTTCG
CCGCCACTGCCTTCGTCGGGCTGGCCCTGGCGGGCTGGAGCTGGTCCTATATCGGCAACCGCCAGCTGAC
CGCCAACGTCCAGGCAGACCTGGACAAGGCCATCAAGCTGCAGGAAAAACGGCTGGACCTGCAATCGCGT
TTCGAAGCAATGGAGATCCTGCAAGACCGTATCGAGCAATTGCAAAAATACGACAACCACCGGCCCCTGT
CGGTCGGTTTCGGCCTGTACCAGGGCGAACTGCTGGAGCAGAAGCTGCGGGAAGAATATTTCGCCGGCGT
CAAGGACATCATGCTCAAGCCGGTGACCGCGAATATCGAATCCTTCCTGTCTGAAATGAATGCCCATGCC
GGTTCGCTGGAGCCGATGTCGCGTCCGGTGCAGCTGGTGGCCGGCGCGGCGCAGCCGGCGGCTGGCGCTG
CGGCTGCAGCAAGCACGGCGGCAGCGCAGGCAGCCAATGCCGGCAGCACCCAGCAATACAAGGATTCTTC
GCCGACCAATGTGGAAGACGGCTACAACGCCCTGAAGACCTACCTGATGCTGAGCGACCGCTCGCGCGCC
GAGTCTAGCCATCTGAACGACCAGCTGACCCGCTTCTGGCGCGGCTGGCTGGAAAGCAACCGCGGCAACA
TGACGCGCGAACAGATGATTCGCAGCGCCGAACGCCTGATGAGTTTTTACCTGTCGCAAGTCAGCGATCC
GTCCTGGCCTACGATTGAAAGCAAGCTGACCCTGGTCGACCAGTCGCGCGACAACCTGCGCCGCGTGGTG
CGCGGCATGGCAGCGCGCGACCGGGTGTATGCGGATATCAAGGCGCGCGCCTCGACCCGCTTCCCGTCGA
TCACGGTGGCCAGCATCGTCGGCGACCAGGACAAGGAACTGATTGTCGGCAGCTACGCGATTCCGGGCAC
CTTCACCCGCGACGCCTGGGAGAAATTCGTCCAGGGCGCGTTCAAGGAAGCCGCCAACAAGGAACTGCAA
AGCGCCGACTGGGTGCTCAAGACCGCCTCCAGCGACGACCTGACACTGGAGGGCAGCCCGGAGCAGATCC
AGAAAGCCCTGGTTACCCAATACAAGACTGAGTACGCCAAGGAATGGCAGAAGTTCATGCAGGGCGCCAA
TATCGCCGACCTCGGCGGCTTCGACAACGCGGTCAAGGCGATGAACCGTTTCGGCGATCCTTCCACTTCG
CCGATCAACAAGTTCGTCACCGCGGTTTACCAGCAGACCTCATGGGACAATCCGTCGCTGCTGAACACCG
GCCTGGGGCGCGCGCAAAGCGGCTTCATCGCCTGGTTCAAGCAAACCATCCTGCGCCAGGCGCCGTCCGG
GGTGAACGTCAACGTCAACCTGAATACCAGTACCGACCCTACAGCCGCGCCGATGGGCCCGGTCGGCAAG
GAGTTCGCGGGCGTCGCACGCATGGTGACGGCCAAGGACAAGGACGCCACGCTGATGCGCGGCTACATGG
AAAGCTTGTCGAAACTGCGCACCCGCTTCAACCAGATCAAGAACCAGGGCGATACCGGCCCCGGCGCCAA
CCAGCTGATGCAGCAGACCTTGAACGGCAGCGGTTCGGAACTGGCCGACGCTCTCAAGTATGTGGATGAG
CAGATGCTGGTCGGCATGAGCGATTCGCAGAAACAGGCGATCCGTCCGATCCTGGTGCGGCCGCTGATCC
AGGCTTTCGCCGTCACCATCAAGCCGACCGAGGCGGAGATGAACCGCACCTGGCTGGCGCAGGTGTATTC
GCCGTTCGAGAAAACCCTGGCGGAAAAATATCCGTTTGCCGCCAATTCGAAAATCGAAGCGACCAGCGCC
GAAATCGGCCAGACTTTCGGTCCGGACGGTAGCATTGCCAAGTTCGTCAATTCTTCCATGGGTCCGCTGG
TGGTGCGCCGCGGCGACACTCTGGCCGCCAAGACCTGGGCTGACATGGGCATCACGCTGTCGCCAACCAT
GGTGTCGAGTTTCGCACGCTGGGTAGCGCCGCTGGGCGCCAGCAGCGCGGCAGCCGGCGGCAGCGCCGGC
GGAGCGGATGCGCAAACCGTATTCCAGATACAGGCGCTGCCGGCCGGCGGCACCACTGAATACACGATCG
AGATCGATGGCCAGCAACTGCGTTACCGCAACACCCAGGCGCAATGGACCAACTTCGTGTGGCCTAACCC
GCAAGGCGTGGCCGGCGCCCGCATCACGGCCGTCACCTTCGACGGCCGGACGGTTGAAATCGCCAACCAG
CCTGGCCGTTTCGGCCTGGAGCGCCTGATCAACACGGCGGTGCGCAAGCGCAAGGACGGTAATTTCGAAC
TGAGCTGGACCAACGAAAACATCACGGTGCCGATCAACCTGAAGATCATCAGCAGCCCGCAGGTCAGCGC
CAAGTCGCCTGACGGCGGCGCCCAGCAAGGCCAGGGTTTCCGCGGCATGAGACTGCCGGAAACCATCGTC
GGCACAGCGGCCAGCCCGGTCAGCAACCCTGCTGCGCCAGCGGCCGGAGCAGCACCGGCCCCGGCTGTCA
GCGCGGCGGGTACAGCGCCGGCCGGAGCAACGGCTGCCGCAGCACCGGCTGCCGCAGCAACTGCAGGAGG
GGCCGTACAATGA
 Primer design