SecReT6
Protein ID: 34499435
SecReT6 ID49
T6SS typei4b
Gene symbol-
Locus tagCV_3980
StrainChromobacterium violaceum ATCC 12472
Repliconchromosome [GenBank: NC_005085] [Browse all T6SS(s) in this replicon]
Location [Strand]4304734..4308516 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ7NR05
KEGG IDcvi:CV_3980
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.50E-71, Aligned region: 184..441
IcmF-related [PF06761], Evalue: 2.10E-44, Aligned region: 490..554
IcmF-related [PF06761], Evalue: 2.10E-44, Aligned region: 635..880
DUF1215 [PF06744], Evalue: 6.30E-29, Aligned region: 1001..1114
Protein Sequence: 1260 a.a.     [Download]
>gi|34499435|ref|NP_903650.1| hypothetical protein CV_3980 [Chromobacterium violaceum ATCC 12472]
MLHKGWLRNAKVASAIGFLILIALIWWLGPWLGLKSVEARLGWIVAVMIVWVLALLIGQALARRAGGLLE
GMLRRQADDAVINASADKRAEVTLLRQRLLGAIDTLKKSNLGSARGSAALYELPWYMIIGHPAAGKSSAI
LQSGLSFPFSDKSGIQGVGGTRNCDWFFSTEGVLLDTAGRYATESEDRTEWLAFLKLLKKHRAKAPVNGI
MVAISLPELAQHNSEGFVLYARQVRERIHEVCNTFGLMVPIYLVFTKLDLLGGFAQFFHDAGEEERSRVW
GATLSADQGTGFDAGAVVSQQFEQLYRGLVQMGEEKLVGARGDAVKSAHFAFPIEFHGLQEAVVKFVRLL
FEEDPYHSRPLLRGFYFTSALQEGVPRIVTAGRVQGQFDLSSAGIDKHQAPASYSYFLRGLFREVLFPDQ
HLIFQQTRPSGSRWRLVGMAAGLVSLAAVAGAWTWSFVGNQQMIAQVNAERVQAQKLAASGQLYDRLNGL
LILQRRLEELQNYRRNGEPWQVGLGLYQGEELERNLRKAYFAGLKDVMLRPVQKNLETTLAALKPGAVQP
VAVTQPPKPEPKPEAKPAPAPKPLKPYKPRPKHGLPNIQLGALELPQRATTAKLDASAPAAGEPAAESGQ
PQKSQKLDVAYNALKTYLMLHDRRRMEEAHLADQLPRYWRPWLESQRGEYPVSEVMGQAEKLVAFYVSQI
KEQDLPLIDNDVKVVADARDVLRGSFKQLSAQERVYNEIKARANTRFAPLTVARILDNRDMDIMASSQMV
EGAYTREAWNTYVRAAIDEASKGTIRSDDWVLASSTQDDLGKDGDVEKNRAALEALYRAQYIAAWHKFLA
GVVVRDITNPAQSASAMTRLADKQNSPIKLILARAAQETSWDNPSELNRSLETAKRSVLEKTTEFFKSGD
APAAKNEKQYGVVGAHFAGVAALVKGDNSPLNGYLDQLGKLKVKMAAIATTDQPGPQARTALQSTLSGSG
SELGDTLSYVDNTLLAGATSDTVEMVRPMLLRPLSQSYSALLGPVAQDINQAWANEVLPQWKQLASKYPF
SDSSSSASVADISRFVKANDGTLDKFINKYLTGLVQKKGDELVPRVWGNQGVRFNPQFLSGVSSLMALAN
TQLQDGENSRFELQPLPTPGLSEIVLSIDGQELRYRNGPQQWQPFNWPGSNGEGARIQVVNYAGSSTVVG
NQSGRMGLMRLLAGAKVSQDGDGAQLTWALPKGSGAEGQTVRFNFRMLGGVNPLQLNRLYKLTLPERVTL
 
Nucleotide Sequence: 3783 bp     [Download]
>gi|34495455|ref|NC_005085.1|:c4308516-4304734 Chromobacterium violaceum ATCC 12472 chromosome, complete genome
GTGTTACACAAAGGTTGGCTACGCAATGCCAAGGTGGCGTCTGCCATCGGATTCTTGATCCTGATCGCGC
TGATATGGTGGCTGGGTCCCTGGCTGGGCCTGAAGTCGGTCGAGGCGCGCCTGGGCTGGATCGTGGCGGT
GATGATCGTATGGGTGCTGGCGCTGCTGATAGGCCAGGCGCTGGCCCGCCGCGCCGGCGGCTTGCTGGAA
GGCATGCTGCGCCGTCAGGCCGACGACGCGGTGATCAACGCCAGCGCCGACAAGCGCGCGGAGGTGACGC
TGCTGCGCCAGCGTCTGCTGGGCGCGATCGACACGCTGAAGAAGTCCAATCTCGGCAGCGCCCGCGGCAG
CGCGGCGCTGTACGAATTGCCGTGGTACATGATCATTGGTCATCCGGCCGCCGGCAAAAGTTCCGCCATC
CTGCAGTCCGGTCTGAGCTTCCCGTTCAGCGACAAGAGCGGCATTCAGGGCGTGGGCGGCACCCGCAACT
GCGACTGGTTCTTCTCCACCGAGGGCGTGCTGCTTGACACCGCCGGCCGTTACGCGACCGAGAGCGAGGA
CCGCACCGAGTGGCTGGCCTTCCTCAAGCTGTTGAAAAAGCACCGCGCCAAGGCGCCGGTCAACGGCATC
ATGGTGGCGATCAGCCTGCCGGAGCTGGCCCAGCACAACAGCGAAGGTTTCGTGCTCTACGCGCGCCAGG
TGCGCGAGCGCATCCACGAAGTGTGCAACACCTTCGGCCTGATGGTGCCGATTTACCTGGTATTCACCAA
GCTCGACCTGTTGGGCGGCTTCGCCCAGTTCTTCCACGATGCCGGCGAGGAGGAGCGCTCCCGGGTATGG
GGCGCGACGCTGTCCGCCGACCAGGGCACCGGCTTCGATGCCGGCGCCGTCGTGTCGCAGCAGTTCGAGC
AGCTGTACCGCGGCCTGGTGCAGATGGGCGAGGAGAAACTGGTGGGCGCGCGCGGCGACGCGGTGAAATC
CGCCCACTTCGCCTTCCCGATCGAATTCCACGGCCTGCAGGAGGCGGTGGTCAAGTTCGTCCGCCTGCTG
TTCGAGGAGGATCCCTACCATTCCCGTCCGCTGCTGCGCGGCTTCTATTTCACCAGCGCCTTGCAGGAAG
GCGTGCCGCGCATCGTGACCGCAGGCCGCGTGCAGGGCCAGTTCGACCTGTCCTCCGCGGGCATCGACAA
GCATCAGGCGCCTGCCTCGTACAGCTACTTCCTGCGCGGCCTGTTCCGCGAAGTGCTGTTCCCCGACCAG
CACCTGATCTTCCAGCAGACGCGCCCGAGCGGCAGCCGCTGGCGCCTGGTCGGCATGGCGGCCGGCCTGG
TGTCGCTGGCAGCGGTGGCCGGCGCGTGGACCTGGTCCTTCGTCGGCAATCAGCAGATGATCGCCCAGGT
GAACGCCGAGCGCGTCCAGGCGCAGAAACTGGCCGCGTCCGGCCAGCTGTACGACCGCCTGAACGGCCTG
CTGATCCTGCAGCGCCGTCTGGAGGAGCTGCAGAATTACCGCCGCAACGGCGAGCCGTGGCAAGTCGGCC
TGGGCCTGTATCAAGGTGAGGAGCTGGAGCGCAATCTGCGCAAGGCCTATTTCGCCGGCCTGAAGGACGT
GATGCTGCGCCCGGTGCAGAAGAATCTGGAGACCACGCTGGCGGCGCTGAAACCGGGCGCGGTGCAGCCG
GTGGCGGTGACCCAACCGCCCAAGCCGGAGCCGAAGCCGGAAGCGAAGCCGGCCCCTGCGCCGAAGCCGC
TCAAGCCGTACAAGCCGCGTCCCAAGCATGGTTTGCCGAACATTCAGCTGGGCGCGCTGGAGCTGCCGCA
GCGTGCGACTACCGCCAAGCTCGATGCTTCCGCGCCGGCCGCGGGCGAGCCTGCGGCGGAAAGTGGCCAG
CCGCAGAAGTCGCAAAAGCTCGACGTCGCTTACAACGCGCTGAAAACCTATCTGATGCTGCATGACCGCC
GCCGCATGGAGGAAGCGCACCTGGCCGACCAGCTGCCGCGCTACTGGCGCCCGTGGCTGGAGAGCCAGCG
CGGCGAGTATCCGGTCAGCGAGGTGATGGGCCAGGCCGAGAAGCTGGTGGCTTTCTACGTCAGCCAGATC
AAGGAGCAGGACCTGCCGCTGATCGACAACGACGTCAAGGTCGTCGCCGACGCGCGCGACGTGCTGCGCG
GCTCGTTCAAGCAGCTGTCCGCCCAGGAGCGCGTGTACAACGAGATCAAGGCGCGCGCCAACACCCGCTT
CGCGCCGCTGACCGTCGCCCGCATCCTCGACAACCGCGACATGGACATCATGGCCAGCAGCCAGATGGTG
GAGGGCGCCTACACCCGCGAGGCGTGGAACACCTATGTCCGCGCCGCCATCGACGAGGCGAGCAAGGGGA
CCATCCGCAGCGACGACTGGGTGCTGGCGTCGTCCACCCAGGACGACCTCGGCAAGGACGGCGACGTGGA
GAAGAACCGCGCCGCGCTGGAAGCGCTGTACCGCGCCCAGTACATCGCCGCCTGGCACAAGTTCCTGGCC
GGCGTGGTGGTGCGCGACATCACCAACCCGGCGCAGTCGGCGTCGGCGATGACCCGTCTTGCCGACAAGC
AGAACTCGCCGATCAAGCTGATCCTGGCCCGGGCGGCGCAGGAAACTTCCTGGGACAATCCGTCCGAGCT
GAACCGCTCGCTGGAGACCGCCAAGCGCTCGGTGCTGGAGAAGACCACCGAGTTCTTCAAGAGCGGCGAT
GCGCCGGCAGCCAAGAACGAAAAACAGTACGGCGTCGTCGGTGCGCACTTCGCAGGCGTGGCCGCGCTGG
TCAAGGGCGACAATTCGCCGCTCAACGGCTATCTGGACCAACTCGGCAAGCTGAAGGTGAAGATGGCGGC
GATCGCCACCACCGACCAGCCGGGTCCGCAGGCCCGCACCGCGCTGCAGTCCACACTGAGCGGTTCCGGC
TCCGAGCTGGGCGATACGCTGTCCTATGTCGACAACACCCTGCTTGCCGGCGCGACCTCCGACACCGTCG
AGATGGTGCGGCCGATGCTGCTGCGTCCGCTGTCGCAGTCGTACAGCGCCTTGTTGGGCCCGGTGGCGCA
GGACATCAACCAGGCCTGGGCCAACGAAGTGCTGCCGCAATGGAAACAGCTGGCGAGCAAGTATCCGTTC
AGCGACTCCAGCAGCAGCGCGTCGGTGGCCGACATCAGCCGTTTCGTAAAAGCCAACGACGGCACGCTGG
ACAAGTTCATCAACAAGTATCTGACCGGCCTGGTGCAGAAAAAGGGCGACGAGCTGGTGCCGCGCGTATG
GGGCAACCAGGGTGTGCGCTTCAATCCGCAGTTCCTCAGCGGCGTCAGCAGCCTGATGGCCCTGGCCAAT
ACCCAGCTGCAGGACGGCGAGAACAGCCGCTTCGAGCTGCAGCCGCTGCCGACGCCGGGCCTATCCGAGA
TCGTGTTGAGCATAGACGGCCAGGAGCTGCGCTACCGGAACGGCCCCCAGCAGTGGCAGCCGTTCAACTG
GCCGGGCAGCAACGGCGAAGGCGCGCGCATCCAGGTGGTCAACTACGCGGGCTCCAGCACCGTGGTGGGC
AACCAGTCCGGCCGCATGGGCCTGATGCGCCTGCTGGCGGGCGCCAAGGTCAGCCAGGACGGCGATGGCG
CGCAGCTGACGTGGGCGCTGCCCAAGGGCAGCGGCGCGGAAGGCCAGACCGTTCGCTTCAATTTCCGCAT
GCTGGGCGGGGTCAATCCGCTGCAGTTGAACCGCCTGTACAAACTGACGTTGCCCGAGCGCGTGACGTTG
TAA
 Primer design