SecReT6
Protein ID: 345299103
SecReT6 ID457
T6SS typei2
Gene symbol-
Locus tagEntas_1938
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]2083457..2086894 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDG2SBZ7
KEGG IDeas:Entas_1938
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.20E-70, Aligned region: 420..738
DUF1215 [PF06744], Evalue: 1.90E-35, Aligned region: 861..981
Protein Sequence: 1145 a.a.     [Download]
>gi|345299103|ref|YP_004828461.1| ImcF domain-containing protein [Enterobacter asburiae LF7a]
MVKENKPAEFSVLATAVLFVATVTLLVLAGGLLWWYWGEDLSTEWDVIRRIMTACFVVWGVSLCLLVLGF
IAFHLMIRDKVIGEASSRPVKKKRTHPLPLKADISSHLRRRYNLFWRRKVRLLLVTGDENAIAQLVPNLQ
ARQWLEGNRTVLIYGGSLTAEPDEKKYTALRKLRRGRPLDGIVRVIGEGQSITPQMSDSDLRGLEKISEL
LRYSVPVYLWQLCDSDWPQAKRTEQTVGATFPLRAKPDDITRQLEIMLPTLRMQGVSQVAENNSHDFLLR
LSQHLKDGGIARWAQQLLPWLSVSQQRVPLRGLMFSLPENKPADTSGGTASAEKYVPESQRHSLTLPVAW
QGVVDDCTRVRGHRVGMAWEQMLAWGLMGAIGIWGAGMLLSFILNYSQISFVASKAHDLVDHASVSDYQL
TALHDLRNDAGRLQNHIQKGTPWYQRFGLDHNKQLLDAMLPWYGVANNRLIRDPANAALTQKLHALANSE
PNSDRRAQLAKPGYGQLKAWLMMARPDKVDGAFYAQTLKTVQPTRMAISTGLWQSLSPDLWAFYISELPK
QPQWKITPDAQLVSQSRQVLLQQIGRRNAESTLYENMLKSVRRNFADVSLEDMTSGTDARRLFTTDEVVP
GMFTRQAWEGGIQQAIEKAANSRRDEIDWVLSDSRKAISADLSPDALKARLTQRYFIDFAGSWLNVLNSL
QWNPVQNIADVTDQLTLMSDVRQSPMIALMNTLAWQGQTGQQTEGLSDSLIKSAKDLIGNKDKPAIDQTA
AGPQGPLDDTFGPLLTLMGKNKASSVMSADSSLSLQTYLTRITRVRLRLQQVASASDPQEMMQTLAQTVF
QGKSVDLTDTQQYGSLVAASLGEEWSGFGRTMFVQPLTQAWETVLQPSAASLNDRWSRSVVANWRTAFDG
RFPFAAGKSDASLPMLAEFIRKDSGRIDRFLTTELNGVLHKEGSQWVPDSAHSQGLTFNPAFLRAVNQLS
QLSDILFTDGSQGISFELQARPAAQVVETQLTIDGQQLHYFNQMADWQSFRWPGDTYKPGTMLTWTSTSA
GARLFGDYSGTWGFIRWLDQGKRQQLDRSQWMMSFTAPDGRTLQWVLRSQLGNGPLALLDLRGFTLPDQI
FSVDSAATAQALMANTENNDMEGVE
 
Nucleotide Sequence: 3438 bp     [Download]
>gi|345297184|ref|NC_015968.1|:2083457-2086894 Enterobacter asburiae LF7a chromosome, complete genome
ATGGTGAAGGAAAATAAACCCGCTGAATTTTCTGTGCTTGCCACGGCGGTGTTGTTTGTTGCTACTGTCA
CGCTGCTTGTGCTGGCAGGTGGGTTGCTGTGGTGGTATTGGGGGGAGGATCTCTCCACAGAATGGGACGT
GATACGTCGAATCATGACGGCCTGTTTTGTTGTCTGGGGAGTGTCGCTCTGCTTACTGGTGCTGGGGTTT
ATCGCTTTTCATTTAATGATTCGGGATAAAGTGATTGGGGAGGCTTCTTCCAGACCGGTCAAAAAGAAAA
GGACGCACCCGCTGCCGCTCAAGGCGGACATCAGCAGCCATCTCCGTCGCCGCTATAACCTCTTCTGGCG
ACGTAAAGTCCGTCTGCTGTTAGTTACAGGCGATGAGAACGCCATCGCTCAGTTGGTGCCCAACCTACAA
GCCCGTCAGTGGCTGGAAGGAAACCGCACGGTCTTGATTTATGGCGGCAGCCTGACCGCTGAACCCGACG
AAAAAAAATATACCGCCCTGCGCAAGCTGCGACGTGGTCGTCCTCTGGACGGCATCGTGCGCGTAATAGG
CGAGGGACAGAGTATTACGCCGCAGATGAGTGATAGCGATCTGCGCGGCCTGGAAAAAATCAGCGAGCTG
CTGCGCTATTCCGTCCCGGTTTATTTGTGGCAGCTGTGCGACAGCGACTGGCCGCAGGCAAAACGTACTG
AACAGACGGTGGGGGCTACTTTCCCGCTGCGTGCTAAGCCTGACGATATTACTCGCCAGCTTGAAATTAT
GCTGCCGACCCTGCGGATGCAGGGGGTGAGTCAGGTCGCAGAGAACAACAGCCACGACTTCCTGCTGCGT
CTGAGTCAGCACCTGAAAGACGGCGGCATCGCCCGCTGGGCTCAGCAACTTCTGCCATGGCTTTCTGTTT
CCCAACAGCGCGTTCCGCTGCGCGGCCTGATGTTCAGTTTGCCGGAGAATAAACCTGCTGATACGTCAGG
GGGAACAGCCAGCGCTGAGAAATATGTTCCGGAATCTCAGCGCCATTCCCTGACTCTGCCGGTGGCCTGG
CAGGGGGTGGTTGACGACTGCACCCGCGTACGTGGTCATCGTGTCGGTATGGCCTGGGAACAGATGCTGG
CTTGGGGGCTAATGGGGGCGATCGGCATCTGGGGCGCGGGCATGCTGCTTTCCTTTATCCTGAACTACAG
CCAGATTTCCTTTGTGGCAAGTAAAGCGCATGATTTAGTGGATCATGCTTCGGTCTCCGATTACCAGCTG
ACGGCGCTGCACGATCTGCGAAACGACGCCGGTCGCTTGCAAAACCATATTCAGAAGGGCACCCCCTGGT
ATCAACGTTTTGGGCTTGATCATAATAAGCAACTGCTCGACGCGATGCTGCCGTGGTACGGCGTGGCAAA
CAATCGCCTGATCCGCGATCCGGCTAATGCTGCACTGACTCAAAAACTCCATGCGCTGGCTAATTCAGAA
CCAAACAGCGATCGGCGTGCTCAGCTTGCGAAGCCCGGCTATGGACAGCTGAAGGCCTGGTTGATGATGG
CCCGCCCGGATAAAGTCGACGGCGCGTTTTACGCTCAAACCCTGAAAACCGTACAGCCGACGCGCATGGC
CATCTCAACTGGCCTGTGGCAGAGCCTGTCGCCGGATTTATGGGCGTTCTATATCTCAGAATTACCAAAA
CAGCCGCAGTGGAAAATTACGCCTGACGCGCAACTGGTCAGCCAGAGTCGTCAGGTGCTGTTGCAGCAGA
TAGGCCGCCGAAACGCGGAAAGCACGCTGTATGAAAACATGCTTAAATCGGTGCGCCGTAACTTTGCCGA
TGTATCACTAGAGGACATGACCAGCGGTACTGACGCCCGCCGCCTGTTCACCACTGATGAAGTGGTTCCG
GGGATGTTCACCCGTCAGGCCTGGGAAGGCGGCATTCAGCAGGCTATCGAAAAGGCTGCAAACTCCCGCC
GCGATGAAATTGACTGGGTGCTGAGCGATAGCCGCAAAGCCATTTCTGCCGATCTCTCGCCGGACGCATT
GAAAGCCCGCCTCACCCAGCGCTATTTCATCGATTTTGCCGGAAGCTGGCTGAACGTCCTCAACAGCCTG
CAGTGGAACCCGGTGCAGAATATTGCGGACGTGACCGACCAGCTGACGCTGATGAGCGACGTGCGCCAGT
CGCCGATGATTGCCCTGATGAACACCCTGGCGTGGCAGGGGCAGACCGGGCAGCAGACGGAAGGGCTGTC
TGATTCGCTCATCAAGTCGGCAAAAGATCTTATCGGCAACAAAGACAAGCCCGCTATCGATCAAACCGCC
GCCGGGCCGCAGGGGCCGTTGGATGACACCTTCGGTCCGTTGCTGACGTTGATGGGTAAAAACAAAGCCA
GCAGCGTTATGTCTGCGGATAGCTCGCTGAGTCTGCAAACCTACCTGACCCGCATCACCCGCGTGCGTTT
ACGCCTGCAGCAGGTGGCAAGTGCTTCTGATCCACAGGAGATGATGCAGACCCTCGCCCAGACCGTGTTT
CAGGGCAAGAGCGTCGATCTGACCGATACTCAGCAGTACGGCAGCCTGGTGGCGGCAAGCCTCGGTGAAG
AGTGGAGCGGATTTGGCCGCACGATGTTCGTACAGCCGCTGACCCAGGCCTGGGAAACGGTTTTACAGCC
CTCTGCGGCCAGCCTCAATGACCGCTGGAGTCGCTCGGTGGTGGCGAACTGGCGTACGGCCTTTGACGGC
CGATTCCCGTTCGCGGCAGGCAAAAGCGATGCCTCTTTACCCATGTTGGCAGAGTTTATTCGTAAGGACA
GCGGGCGCATCGACAGGTTCCTGACCACGGAGTTAAACGGCGTGTTGCACAAAGAGGGCAGCCAGTGGGT
GCCGGATAGCGCCCACAGCCAGGGGCTGACGTTCAACCCAGCCTTCCTGCGGGCGGTTAACCAACTGAGT
CAGCTGTCCGACATCCTCTTCACCGACGGCAGCCAGGGGATTAGCTTCGAGCTACAAGCCCGCCCGGCAG
CGCAGGTGGTGGAAACCCAACTGACGATTGACGGACAGCAGCTACATTATTTCAACCAGATGGCTGACTG
GCAGTCCTTCCGCTGGCCGGGGGATACCTACAAGCCGGGCACCATGCTTACCTGGACTTCAACCAGTGCG
GGCGCGCGCCTGTTCGGCGATTACAGCGGCACCTGGGGCTTTATTCGCTGGCTGGATCAGGGCAAGCGAC
AGCAGCTTGACCGCAGCCAGTGGATGATGAGCTTCACTGCCCCGGATGGTCGTACCCTGCAGTGGGTACT
GCGTTCGCAGCTTGGAAACGGTCCGCTCGCGCTGCTGGATCTGCGCGGTTTTACGCTGCCGGATCAAATT
TTCAGTGTCGACAGCGCGGCCACCGCTCAGGCGCTGATGGCTAATACGGAAAACAATGACATGGAGGGAG
TCGAGTAA
 Primer design