SecReT6
Protein ID: 345300985
SecReT6 ID458
T6SS typei1
Gene symbol-
Locus tagEntas_3848
StrainEnterobacter asburiae LF7a
Repliconchromosome [GenBank: NC_015968] [Browse all T6SS(s) in this replicon]
Location [Strand]4135929..4139588 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDG2SCQ3
KEGG IDeas:Entas_3848
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.60E-77, Aligned region: 528..841
ImcF-related_N [PF14331], Evalue: 6.00E-55, Aligned region: 219..477
DUF1215 [PF06744], Evalue: 5.60E-31, Aligned region: 238..271
DUF1215 [PF06744], Evalue: 5.60E-31, Aligned region: 410..425
DUF1215 [PF06744], Evalue: 5.60E-31, Aligned region: 761..800
DUF1215 [PF06744], Evalue: 5.60E-31, Aligned region: 960..1077
Protein Sequence: 1219 a.a.     [Download]
>gi|345300985|ref|YP_004830343.1| type VI secretion protein IcmF [Enterobacter asburiae LF7a]
MYFINKIASWLSPLRAMKVFAGKLLQLKPLLPRFSLSLTLLWLIWGMGLLAIWLWGPLWTWGEIKPLGSA
GNRIVATLLLLLLGLSAVSWYLYKQVQRALPGQQAAENLPYQASIDHQARFLDEWLQHYSQRSHLKNAMY
SRPWYMMIGESISGKSTLIRKSDQVIPLNFQSELKREMSDGKALKSLGLFLTQSAVLIDPPGEFFQQDEH
DKDKEHHRGRRLLQHLLDWLITHRPRQPLNGVVLTINIQELMAMTAENRRMWAQRWQTQILALSDRFACR
VPVYIVINKIDVLNGFEAIYPALSQQMRNKTLGVSFSLEAEQGDSWRKELKVFWEEWQQNLNQLMPEQMI
NGTTIDLRTALFCFIGQLSALQAVTVETINDLLRHYNRDPGRQMLIRGLYFTSAIQQNRRSDFFQDAIAE
RYGLRTTTQGVWQPKDNQSGYFLHDLFSNTLFSEPNLAGENYEFTRLRRHQLTLATVIAGGVALSLLSGW
YYYYLKNYRAGEIALKKVETFQKIGSPDVSKPLGADWLPHMDIIRDATLSYGDYHEKNSLFSDMGLYQGD
RIGQLVEKTYLRFLTQRFLPQLMTDLQKQLEAAPDNRDEKLALLRIMRMLEDKSGRSIPLVEEYMRGRWQ
NAFTGQREVQERLMQHLDYALQHTDWAGDRRKGDRDAIKAWEPFVGHVQSAQRELSRLPLYQRVYQNLGI
KAREQLPPDLDLRTEIGAQFDTVFVADEEALLKIPQFWTRYGLGHYLTTQMGRLVDITRLDAWVLKLTEH
TDYSEADKREIQRQITDRYVGDYVSRWRNALTNLSIRPFADISEATDALDAVLNNGQPIWRALLLLRDNT
QTQLQAAIVDPDIPVAGSAKKEQKVAQVLNIAQKNTLEQMENQPDYILLNRIGRSFTEQKALVEHSDDQN
GQLRQAYNALTAMNAELHRISNAPEPGKAALLLVQMRFQQNNADTFFTAKQMSRNLSDPLGRWVGQLADN
SWETVMGLALQSLEKEWSGKVVTPFLSQLADKYPFNRRATKDVALSDMERFFAPDGVIDSFYKDNLKVFV
EGRASAVDGKSVIRPEIVRSLQQADKIRSIFFSKQNGFSIQYAISPIELSANKRRAVLNLDGQLIDYTQG
NPTTAHLVWPNAMRSGNESKITLVPNAVGASPRSIGYSGPWATFHILDKGELTSIQDGSFDIRFTVDGGA
VSYRVYMDASDNPFAGDIFSQFTLMDQLY
 
Nucleotide Sequence: 3660 bp     [Download]
>gi|345297184|ref|NC_015968.1|:c4139588-4135929 Enterobacter asburiae LF7a chromosome, complete genome
ATGTATTTTATAAATAAAATCGCCAGCTGGCTGTCTCCATTGCGGGCAATGAAGGTATTCGCAGGCAAAT
TATTACAACTTAAACCTCTGTTACCCCGTTTTTCATTGTCTTTGACGTTACTCTGGTTGATATGGGGAAT
GGGGCTGCTTGCCATTTGGTTATGGGGGCCTCTGTGGACATGGGGAGAAATAAAACCGCTGGGATCGGCA
GGCAATCGCATTGTGGCAACGTTGCTTCTTTTGCTGCTGGGGCTGAGTGCCGTCAGTTGGTATCTCTATA
AACAAGTGCAGCGTGCCTTACCCGGTCAACAGGCAGCAGAAAACCTGCCTTATCAGGCGAGTATCGACCA
TCAGGCGCGTTTTCTTGATGAATGGCTGCAGCACTATTCCCAGCGTAGCCACCTCAAAAATGCCATGTAC
AGCCGCCCCTGGTACATGATGATAGGGGAGAGTATCAGTGGCAAAAGTACCCTGATCCGCAAATCCGATC
AGGTTATTCCGCTCAACTTCCAGAGTGAGCTGAAGCGAGAGATGTCCGATGGCAAAGCGCTTAAATCGCT
GGGGCTGTTCTTGACCCAGTCTGCTGTTCTGATCGATCCTCCCGGGGAATTCTTCCAGCAAGATGAACAC
GATAAAGACAAAGAGCACCATCGGGGCAGGCGATTACTGCAGCATCTTCTGGACTGGTTAATCACGCATC
GTCCTCGCCAGCCGCTTAATGGTGTGGTTTTAACGATTAACATCCAGGAATTGATGGCGATGACGGCTGA
GAATCGCCGTATGTGGGCGCAACGGTGGCAAACCCAAATTCTGGCGCTAAGCGATCGTTTTGCATGCCGC
GTTCCAGTCTATATTGTCATCAATAAAATCGATGTACTGAATGGTTTTGAGGCGATATATCCTGCTTTAT
CGCAACAAATGCGCAATAAGACCCTTGGGGTTTCATTCTCTTTAGAAGCGGAACAAGGAGATAGCTGGCG
TAAAGAGCTTAAAGTGTTTTGGGAAGAGTGGCAGCAAAATCTAAATCAGCTGATGCCTGAGCAAATGATC
AATGGGACCACGATCGATCTCCGCACGGCGTTGTTTTGCTTTATAGGTCAACTTTCTGCGCTGCAAGCAG
TGACCGTAGAGACCATCAACGATCTCTTAAGGCATTACAATCGCGATCCGGGCAGACAAATGCTTATCCG
TGGCCTCTATTTTACGTCAGCAATCCAACAAAACAGACGCAGTGACTTCTTCCAGGATGCCATTGCAGAA
CGGTATGGATTACGTACGACGACGCAGGGCGTCTGGCAACCAAAAGACAACCAGAGCGGGTATTTTCTTC
ACGATCTTTTTTCGAACACTCTTTTCTCTGAGCCTAATCTTGCCGGTGAGAACTATGAATTTACGCGCTT
GCGCCGCCATCAGTTAACACTTGCAACGGTCATTGCCGGTGGGGTTGCATTGTCGCTGCTCAGTGGCTGG
TATTATTACTATCTCAAGAATTATCGCGCAGGTGAGATAGCCCTTAAAAAAGTCGAAACCTTTCAGAAAA
TCGGCTCGCCTGATGTCAGTAAGCCCCTCGGTGCCGACTGGTTACCGCACATGGATATTATTCGTGACGC
TACCCTGTCTTATGGCGATTACCATGAGAAAAACTCGCTGTTTTCAGATATGGGGTTATATCAGGGAGAC
AGAATTGGACAACTGGTTGAAAAGACCTATCTCCGTTTTCTGACGCAGCGTTTTTTGCCGCAGCTCATGA
CCGATCTGCAGAAGCAACTGGAAGCTGCTCCAGATAACAGGGATGAAAAATTAGCGCTACTGCGCATTAT
GCGCATGCTCGAAGACAAAAGTGGGCGCAGCATTCCGCTTGTTGAAGAGTACATGCGTGGACGGTGGCAA
AATGCATTTACCGGGCAGCGAGAGGTGCAGGAGCGGCTGATGCAGCACCTGGACTACGCATTACAGCATA
CTGACTGGGCGGGAGATCGACGTAAGGGCGATCGCGATGCGATTAAAGCCTGGGAGCCGTTTGTCGGCCA
TGTCCAAAGTGCCCAGCGCGAACTGAGTAGGCTCCCGTTATACCAGCGTGTTTATCAAAACCTGGGTATT
AAGGCTCGGGAGCAACTTCCCCCCGATCTCGATCTTCGCACTGAAATTGGGGCGCAGTTCGATACGGTCT
TTGTCGCAGATGAAGAGGCACTGTTGAAAATCCCTCAGTTCTGGACGCGCTATGGCCTGGGGCATTACTT
AACCACACAAATGGGTCGGTTGGTCGATATCACTCGGTTAGATGCATGGGTGTTAAAACTGACTGAGCAT
ACTGACTACAGTGAAGCGGATAAACGGGAGATCCAGCGTCAGATTACCGATCGCTATGTTGGCGATTATG
TTAGCCGCTGGCGCAATGCGCTCACGAATCTCTCTATTCGACCTTTTGCCGACATCTCCGAAGCGACGGA
TGCGTTAGATGCCGTATTGAATAACGGGCAGCCTATCTGGCGAGCCTTACTGCTGTTAAGGGATAACACG
CAAACTCAGCTTCAGGCCGCTATTGTCGATCCTGACATTCCTGTTGCCGGCTCGGCTAAAAAGGAACAAA
AGGTTGCGCAGGTGCTCAACATTGCGCAGAAAAATACGCTGGAGCAAATGGAGAATCAGCCCGACTATAT
ATTACTCAACCGTATTGGTCGCTCCTTTACAGAACAGAAAGCACTGGTCGAGCACAGTGACGATCAGAAT
GGGCAGTTGCGGCAGGCATACAATGCGCTAACAGCAATGAATGCCGAATTGCATCGCATCAGCAACGCCC
CAGAGCCCGGCAAGGCGGCGCTGCTACTGGTGCAAATGCGTTTCCAGCAAAATAATGCCGATACATTCTT
CACTGCGAAACAGATGTCGAGAAACCTCTCTGACCCTCTTGGACGTTGGGTTGGCCAATTGGCAGATAAT
AGCTGGGAAACCGTGATGGGTCTTGCATTACAATCGCTTGAAAAAGAGTGGTCAGGCAAAGTGGTAACCC
CATTCCTTTCACAACTGGCAGACAAATATCCGTTTAACAGAAGAGCGACAAAAGATGTTGCTCTCAGCGA
TATGGAACGCTTCTTTGCACCGGATGGTGTCATCGACAGTTTCTACAAAGATAACCTGAAAGTGTTTGTT
GAGGGACGCGCCAGTGCCGTGGATGGGAAATCGGTGATTCGCCCTGAAATCGTCAGGTCTCTTCAGCAAG
CAGATAAAATACGTTCGATTTTCTTCTCAAAACAAAATGGTTTTAGTATTCAATATGCTATATCGCCGAT
AGAGCTTAGTGCTAATAAGCGTCGTGCTGTCCTTAATCTTGATGGTCAATTGATTGATTATACGCAAGGG
AACCCTACGACGGCCCATCTTGTCTGGCCAAATGCGATGCGCTCCGGAAATGAAAGTAAAATTACGCTTG
TGCCCAATGCGGTGGGAGCATCGCCGCGGAGCATAGGATATTCTGGCCCATGGGCAACTTTCCATATTCT
TGATAAAGGCGAATTAACCAGTATTCAGGATGGCAGCTTTGATATCCGCTTCACAGTTGATGGTGGAGCA
GTGAGCTATCGTGTTTATATGGATGCATCCGATAATCCATTCGCTGGAGATATATTTAGTCAATTTACAT
TGATGGATCAACTTTACTGA
 Primer design