SecReT6
Protein ID: 345301722
SecReT6 ID456
T6SS typei4b
Gene symbol-
Locus tagEntas_4615
StrainEnterobacter asburiae LF7a
Repliconplasmid pENTAS01 [GenBank: NC_015963] [Browse all T6SS(s) in this replicon]
Location [Strand]124597..128031 [-]
Producthypothetical protein
NoteTssM
UniProt IDG2SDD9
KEGG IDeas:Entas_4615
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.40E-30, Aligned region: 167..365
Protein Sequence: 1144 a.a.     [Download]
>gi|345301722|ref|YP_004821670.1| hypothetical protein Entas_4615 [Enterobacter asburiae LF7a]
MIKKLFVFTGWLLTICMVLAFCVAGALWLEWSTLTTLFVWISILVTGVLLWGFATWLNTFFRENTLKSFL
RKFRLSRQEYVLYKLWRKGVSVIKSIQRKRTSIPWYIFMGERCGKSSLLAGSGLPMFTNSSDDYLVTPTH
TLRWWFFRNVCILDLSSNFLCGTSSFQRSWDKLVGWISRGPAPAGIIVGIDIDDLLNDEGGILHDKARRI
RSQIEPLTRRLKRQLPVYILITQCDKMDGFKVWSQKLSISQIQQVLGHYWQESPDIDGKDDSTLYPLFEN
LKTGLDFARFSMSDTSMSSSERAILLDFPESFSRIKKSLTLFLASLCEPNVYFSAISLGGVWFTASEVQD
SNKSRRTSYFINDLLTQHLSVFSQSRDVVWYHNTKLRYFFISVFLLGTMTLLGISAVSSAKLMKGSIHSL
SQSELTNLLVKNESHQDSPLFYLPFLPVLDYQHNRIESSIVLKIRPRPRDFSYVIEEYKNQVINANPGNQ
RMMILNLAQAIITYEQMLDGTKLENLNQLPAIPDELHISVTESFTTSLERLVADRWMLRQPSGAGYIKSL
RSLLASLINYDPSLMWLTAPIQYPPDINSSDYWHDLPGTVILSGIWTRQGEEQINVWVDLLNLALEGTQN
ESVLKTFLQNLPVKRQDAWRGFLLGVMPLLQDTKPHSLSTDQLISIGEGQSSAMKFSHRINDELDNVNPS
MAQSWLNELRQLQKLPSYTSEPVMFQKARQADIQLRSKLTAWLFKGKLPVPENSVAQQIDAWKVWRLSLN
NVVVQAISQATLSPSLTQGLFVPATKSATGNPQIALFTNFDKLRKSLHSYSQEPGIDAVWSLYRNDADLL
LAHSMARSACWLNEQWKSKVLWPMSKDASAQDYDSRQALSWQYISDFIRNSTKGLLIVSEQGPKSGEFQG
QTLPLNADFLRVARYMLNPEDILDAPEHTNTLTGDKLAIIEDQITTLTKQLNTLTEKIFQVTIISGPATI
PEKARLVPIGSSLTLVCQNGSQIIDSMNFAEHAQFNWQPGLCQGVKLDVKFPGFTATYRYTGNSAWPDFI
SDLVSGEALLDTNNFDDGIDLLEELGIKHVLVRFKIMNQQPLQEAWSEWNSLDEKIMVLIQQQQSLKEQL
EIQQPSAALRGRFSELPKNVAECN
 
Nucleotide Sequence: 3435 bp     [Download]
>gi|345301597|ref|NC_015963.1|:c128031-124597 Enterobacter asburiae LF7a plasmid pENTAS01, complete sequence
ATGATTAAAAAACTTTTTGTTTTCACCGGATGGTTACTGACTATATGTATGGTATTAGCCTTCTGTGTTG
CTGGGGCATTATGGCTTGAATGGAGTACCCTCACAACTTTATTTGTGTGGATATCTATACTAGTTACAGG
TGTTTTGCTTTGGGGTTTTGCAACATGGTTGAATACTTTTTTTAGAGAAAATACATTAAAAAGTTTTTTG
CGGAAGTTTCGTCTATCACGGCAAGAATACGTACTTTACAAACTTTGGAGAAAGGGGGTGTCCGTGATAA
AGAGTATTCAGCGTAAACGTACATCTATACCCTGGTATATTTTTATGGGTGAACGTTGTGGTAAATCATC
TTTACTCGCCGGATCAGGTTTACCGATGTTCACTAACAGTTCAGATGATTATTTAGTTACTCCTACCCAT
ACATTGCGATGGTGGTTTTTTCGTAATGTATGTATCCTTGACCTTTCTAGTAATTTTCTGTGCGGAACAT
CTTCTTTTCAACGCTCATGGGATAAGCTAGTTGGATGGATATCTCGAGGCCCTGCACCCGCAGGAATAAT
AGTTGGCATCGACATAGATGATCTATTAAATGATGAAGGAGGTATTCTTCATGATAAAGCCAGAAGAATC
CGCTCTCAAATAGAACCACTTACACGCAGATTAAAGCGACAACTCCCTGTTTATATTTTAATCACTCAAT
GTGATAAAATGGATGGGTTTAAAGTTTGGAGTCAAAAATTATCAATTTCGCAAATTCAACAAGTTCTTGG
TCATTACTGGCAGGAATCTCCTGATATTGACGGTAAGGATGATTCAACACTGTATCCATTGTTTGAAAAC
TTGAAGACTGGGCTCGACTTTGCGCGATTTAGTATGAGTGACACTTCTATGTCGTCCAGTGAACGAGCAA
TCCTTCTGGATTTCCCTGAGTCTTTTTCCCGTATCAAAAAGAGTTTAACACTTTTTCTCGCATCTCTCTG
TGAACCAAATGTCTATTTTTCCGCTATATCTCTGGGTGGCGTGTGGTTTACTGCCTCAGAAGTACAGGAT
AGTAACAAAAGTCGCCGTACTTCCTATTTCATTAACGATTTACTCACCCAGCATCTCTCGGTTTTCAGCC
AATCACGGGATGTTGTTTGGTATCACAATACTAAATTACGGTATTTTTTTATCAGTGTTTTTTTGTTGGG
AACCATGACATTATTAGGAATCAGTGCGGTAAGTAGTGCTAAACTTATGAAGGGTAGCATACATTCTCTT
TCTCAATCTGAATTGACAAACCTACTAGTTAAGAATGAAAGTCATCAGGATTCACCTTTATTTTACTTAC
CATTTCTTCCAGTTTTGGACTACCAGCATAATAGAATAGAATCATCGATAGTTTTAAAAATTCGTCCTCG
TCCCCGTGATTTTTCTTATGTAATAGAGGAATATAAAAACCAAGTCATAAATGCAAATCCTGGTAATCAA
CGCATGATGATCCTCAATCTTGCCCAAGCAATTATTACTTATGAACAAATGCTTGACGGAACTAAGTTGG
AGAATCTTAATCAGTTACCAGCTATTCCCGATGAACTTCATATCAGTGTAACTGAGTCGTTCACAACATC
ACTTGAGCGTCTTGTTGCGGACCGATGGATGCTGAGGCAACCATCCGGTGCAGGCTATATAAAATCCCTG
CGGAGCTTGCTTGCATCCCTCATTAACTATGATCCTTCCCTTATGTGGCTTACTGCTCCAATACAGTATC
CTCCTGATATCAATTCAAGTGACTATTGGCATGACTTACCAGGAACAGTAATACTTTCTGGGATCTGGAC
TCGTCAAGGGGAGGAACAGATCAATGTATGGGTCGATCTGCTCAATTTGGCCCTCGAAGGTACTCAGAAT
GAATCTGTTCTGAAAACTTTTCTTCAGAACCTTCCCGTAAAGCGGCAAGATGCCTGGCGCGGATTCTTAC
TGGGAGTAATGCCTTTATTACAGGACACTAAACCTCATTCGTTATCAACTGATCAACTTATTAGTATTGG
CGAAGGGCAGAGTTCAGCAATGAAATTCTCTCATCGTATAAATGATGAGCTCGATAATGTAAACCCTAGC
ATGGCTCAATCATGGCTAAATGAGCTCCGCCAATTACAGAAACTACCTTCATATACCTCGGAGCCTGTTA
TGTTTCAGAAAGCGCGTCAGGCAGATATACAACTTCGTAGTAAATTAACAGCTTGGTTGTTCAAGGGAAA
ACTTCCTGTACCTGAAAATTCTGTCGCCCAACAAATTGATGCCTGGAAAGTTTGGCGTCTCTCGCTCAAC
AATGTTGTCGTACAGGCCATAAGTCAGGCTACGCTTTCACCATCATTAACACAGGGGTTATTTGTTCCTG
CAACTAAGTCTGCCACTGGTAATCCCCAGATAGCGTTGTTCACTAACTTTGATAAATTGCGCAAATCTTT
ACACTCCTATTCTCAGGAACCAGGGATTGATGCAGTCTGGTCGCTGTATAGAAATGATGCCGACTTGTTA
TTAGCTCACTCTATGGCACGCTCTGCTTGCTGGCTAAATGAACAATGGAAAAGTAAAGTTTTGTGGCCAA
TGAGCAAAGATGCTTCCGCGCAGGATTATGACAGCAGACAAGCTTTGAGTTGGCAATACATTAGTGATTT
TATTCGTAATTCGACCAAAGGATTACTTATTGTCTCTGAACAGGGGCCAAAGTCAGGTGAATTTCAGGGG
CAGACTCTCCCACTGAATGCTGATTTTTTGAGGGTCGCGCGTTATATGTTAAACCCTGAAGATATTCTAG
ATGCACCTGAACATACAAATACGTTGACGGGGGACAAACTTGCAATTATCGAGGATCAAATAACTACGTT
GACCAAACAGCTGAATACCCTTACAGAAAAAATATTCCAAGTAACAATTATAAGTGGCCCTGCTACAATT
CCTGAGAAAGCTCGTTTGGTACCGATTGGCTCCAGCCTGACGCTTGTTTGCCAGAATGGTTCGCAAATTA
TTGACAGTATGAACTTTGCAGAACATGCGCAATTCAATTGGCAACCAGGTCTATGCCAAGGCGTAAAACT
AGATGTTAAATTCCCCGGCTTCACTGCAACATATCGTTATACAGGCAATAGTGCATGGCCTGACTTTATC
TCAGATCTTGTTAGTGGTGAGGCTCTACTTGATACCAATAATTTTGATGATGGTATTGATTTACTTGAAG
AATTAGGTATCAAACATGTACTTGTACGTTTCAAAATTATGAACCAACAACCTCTGCAAGAAGCTTGGTC
TGAATGGAATAGTCTTGATGAAAAAATTATGGTTCTTATACAACAACAGCAATCTCTTAAAGAACAACTA
GAGATTCAGCAACCTTCTGCGGCACTCAGAGGGAGATTTTCTGAGCTTCCTAAAAATGTAGCAGAGTGCA
ATTAA
 Primer design