SecReT6
Protein ID: 346725017
SecReT6 ID460
T6SS typei3
Gene symbol-
Locus tagXACM_2116
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]2422373..2425831 [+]
Producthypothetical protein
NoteTssM
UniProt IDG2LT91
KEGG IDxax:XACM_2116
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.20E-89, Aligned region: 197..459
IcmF-related [PF06761], Evalue: 2.30E-67, Aligned region: 511..809
DUF1215 [PF06744], Evalue: 1.10E-27, Aligned region: 896..1017
AAA_16 [PF13191], Evalue: 0.005, Aligned region: 115..267
AAA_16 [PF13191], Evalue: 0.005, Aligned region: 317..357
AAA_16 [PF13191], Evalue: 0.005, Aligned region: 547..586
AAA_16 [PF13191], Evalue: 0.005, Aligned region: 860..860
AAA_16 [PF13191], Evalue: 0.005, Aligned region: 934..947
Protein Sequence: 1152 a.a.     [Download]
>gi|346725017|ref|YP_004851686.1| hypothetical protein XACM_2116 [Xanthomonas axonopodis pv. citrumelo F1]
MRLVLDFLRTRYVASAAVLALLAMLVWVGGPYLSVGRMQPLASVSGRLLAVAVLLLVWAGWRYLRWRHDN
AKQQRMAGELVGQGASAEDASGNDSRARAAQEQVRLRARFAEAMAVLRRRRRNGPGLHVLPWYLLIGAPG
SGKSTLLQSSGLEFPLKEHGNHAALEGVGGTRNCDWWFADQAVFLDSAGRYTTQDSDAIADAGAWHGFLD
LLRRHRRQPLNGVIVTVSVAELLELDGDAGLSHARAVRHRLDELVDKLRARVPVYLVVTKCDLVSGFAEF
FADLDAAGRAQVWGVSFPQAQAADDTDPLTLFPTELERLLERIDQRVLERLHRARDARERAAVLSFPQQL
RRLQPALMEFVQTAFGRHGYAGQPWLRGVYLSSGTQQGHPIDRVISAVARHFGVAAAGLPPAVSAPRSYF
LPRLLKEVVFAEAGLAGSQPGSAQRRRLLQLACWAVLTATTLGVLSGMAGSYARNVQLIGQVRDALDAYP
AGPLPADAGEAAFYAKALQRFDALARARDVALPPGQSIPWSRRFGLHQGRALARDVQDAYLRDLNGALLP
ALAQSLRRKLEQASNDPQRLYPLLKGYLMLGDPARRDVLHLATLAGTVWRQIFPDDASVRAGLNRHLRAL
LGPVDGARALALDRQQIEQTRASLRTAELPALVYGGLKLTQPGVDAGQAPRLDRRLGLLGDVFERRSGLP
LSAPLPPLFTRQAFQAQTGGGIARGVQQFLADDWVLGTAPLDPLARSQLERQVLALYQRDYIAAWDSLLA
DLVLRPVAQTGQASAVAAKLGGPASPLKALLVLLREHTHALGRTPPAKGGAGAAAGGESTAAAEPDVAAE
PIERHFEPLNRLLDGGPGASALDETLAALTQMSRTLLGAAAGVAADQNDPALLIAAQQAEQLPPPLGNWM
ATLSGRGRALTASSAGEALRNAQRQAAGRECALLVSGRFPFVPGSRNDIPLRDFAELFGPGGRMDRFAQQ
SLLGKVDTSGRSWQWNPGMAAVGADDVLERAQLADEIKQAFFAGGGAQPQVAFTVSIPLQASISRLQLEV
DGQTLDVREGARASQSMTWPGPNPGLVRVAAWDASGQALPVLEYRGPWAWFRALQAGRLRRSGDLDYTAS
LALASATVRMDVQPASLRHPFAASAVQRFSCP
 
Nucleotide Sequence: 3459 bp     [Download]
>gi|346722940|ref|NC_016010.1|:2422373-2425831 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGCGCCTTGTGCTTGATTTCCTGCGCACCCGCTACGTCGCCAGTGCTGCCGTCCTCGCTTTATTGGCCA
TGCTCGTCTGGGTCGGCGGCCCCTATCTCAGCGTGGGCCGCATGCAGCCGCTGGCCAGCGTGAGCGGCCG
CCTGCTGGCCGTGGCCGTGCTGCTGCTGGTGTGGGCGGGGTGGCGCTACCTGCGTTGGCGCCACGACAAC
GCCAAGCAGCAGCGCATGGCCGGCGAACTGGTCGGGCAGGGCGCCAGCGCCGAGGACGCCAGCGGCAACG
ACAGCCGCGCACGTGCAGCGCAGGAACAGGTCCGCCTGCGTGCGCGTTTTGCCGAGGCGATGGCGGTGCT
GCGGCGGCGCCGTCGCAACGGTCCCGGCCTGCATGTGCTGCCCTGGTATCTGCTGATCGGCGCGCCCGGT
TCCGGTAAGAGCACCTTGCTGCAGTCTTCGGGCCTGGAGTTTCCACTCAAGGAACATGGCAACCACGCCG
CGCTGGAAGGGGTTGGCGGTACGCGCAACTGCGATTGGTGGTTCGCCGACCAGGCAGTGTTCCTCGACAG
CGCCGGGCGCTATACCACCCAGGATTCGGACGCCATCGCCGATGCCGGTGCCTGGCACGGCTTTCTGGAC
CTGCTGCGGCGGCACCGCCGGCAGCCATTGAATGGCGTCATCGTGACGGTGAGCGTGGCCGAGCTGCTGG
AGCTCGATGGCGATGCCGGTCTGTCGCATGCGCGCGCGGTGCGTCATCGGCTGGACGAACTGGTCGACAA
ACTGCGCGCCCGCGTGCCGGTCTACCTGGTCGTGACCAAATGCGATCTGGTGTCGGGCTTTGCCGAGTTT
TTTGCCGATCTGGATGCCGCCGGCCGCGCGCAGGTGTGGGGAGTGTCGTTCCCACAGGCGCAGGCTGCCG
ATGACACCGATCCGTTGACGCTGTTCCCCACCGAGCTCGAACGCCTGCTGGAGCGGATCGATCAGCGCGT
GCTGGAGCGCCTGCACCGGGCGCGCGATGCACGCGAGCGTGCCGCGGTGCTGTCCTTTCCACAGCAGTTG
CGGCGGCTGCAACCGGCGCTGATGGAGTTCGTGCAGACCGCGTTCGGCCGCCATGGCTATGCCGGCCAGC
CGTGGTTGCGTGGTGTCTATCTGAGTTCGGGGACGCAGCAAGGCCATCCGATCGACCGCGTCATCTCGGC
AGTGGCGCGACACTTCGGTGTCGCCGCTGCCGGTCTGCCGCCCGCTGTCAGTGCGCCACGCAGTTATTTC
CTGCCACGCCTGTTGAAGGAGGTGGTGTTTGCCGAGGCGGGCCTGGCCGGCAGCCAACCCGGCAGCGCGC
AGCGCCGTCGGTTGCTGCAGCTGGCTTGCTGGGCCGTGTTGACCGCCACCACCCTGGGCGTGCTGTCGGG
CATGGCCGGCAGTTACGCCCGCAACGTGCAACTGATCGGGCAGGTGCGCGATGCGCTCGACGCCTATCCT
GCCGGCCCGCTGCCTGCCGATGCCGGCGAGGCCGCGTTCTATGCCAAGGCCTTGCAGCGTTTCGACGCGC
TGGCGCGCGCGCGCGATGTGGCACTGCCGCCGGGTCAGTCGATCCCGTGGTCGCGACGCTTCGGTCTGCA
CCAGGGCAGGGCCTTGGCGCGCGATGTGCAGGACGCCTATCTGCGCGACCTCAACGGCGCGCTGCTGCCG
GCATTGGCGCAATCGCTGCGACGCAAGCTGGAGCAGGCCAGCAACGATCCGCAACGCTTGTATCCGCTGC
TGAAGGGCTACCTGATGCTGGGCGACCCGGCGCGCCGCGACGTCCTGCATCTGGCCACGCTGGCAGGCAC
GGTCTGGCGGCAGATATTTCCCGACGATGCGTCGGTGCGTGCGGGATTGAACCGGCATCTGCGCGCCCTG
CTGGGTCCGGTGGACGGTGCCCGCGCGCTCGCGCTGGATCGGCAGCAGATCGAGCAGACACGGGCGAGCC
TGCGAACCGCCGAACTGCCGGCATTGGTCTACGGTGGCCTCAAGCTGACGCAACCCGGCGTCGATGCCGG
CCAGGCGCCACGCCTGGATCGCCGCCTGGGCCTGTTGGGCGATGTCTTCGAACGCCGCAGTGGCCTGCCG
TTGTCTGCGCCATTGCCGCCGCTGTTTACCCGCCAGGCGTTCCAGGCACAGACCGGTGGCGGCATCGCGC
GTGGTGTGCAGCAGTTCCTCGCCGACGATTGGGTACTGGGCACGGCACCGCTGGACCCGCTGGCGCGTTC
GCAGCTGGAGCGCCAGGTATTGGCGCTGTATCAGCGCGATTACATCGCTGCCTGGGACAGCCTGCTGGCC
GACCTGGTGCTGCGGCCGGTCGCCCAGACCGGGCAGGCGAGTGCGGTGGCCGCCAAGCTGGGCGGGCCGG
CATCGCCGTTGAAGGCGTTGCTGGTGCTGCTGCGCGAACACACCCACGCACTGGGGCGCACGCCACCGGC
CAAGGGCGGTGCGGGCGCTGCAGCGGGTGGAGAGAGCACCGCCGCGGCCGAGCCCGATGTGGCAGCCGAG
CCGATCGAACGCCATTTCGAGCCGCTCAACCGCTTGCTCGATGGCGGGCCGGGCGCCAGCGCGCTGGACG
AAACCCTGGCCGCGCTGACCCAGATGAGCCGTACGCTGTTGGGCGCTGCTGCCGGCGTTGCCGCCGACCA
GAACGATCCGGCGTTGCTGATCGCCGCGCAACAGGCCGAACAATTGCCGCCGCCGCTGGGAAACTGGATG
GCGACCCTATCCGGCCGCGGCCGCGCATTGACTGCCAGCAGCGCCGGCGAGGCGCTACGCAACGCGCAGC
GGCAGGCGGCCGGGCGCGAGTGCGCGCTGCTGGTGAGCGGGCGCTTCCCGTTCGTGCCGGGCAGCCGCAA
CGACATCCCGTTGCGCGACTTCGCCGAACTGTTCGGACCCGGCGGGCGCATGGACCGCTTTGCGCAGCAA
TCCTTGCTCGGCAAGGTCGATACCAGCGGGCGCAGCTGGCAATGGAATCCGGGCATGGCGGCGGTCGGTG
CCGACGACGTGCTGGAGCGCGCGCAACTGGCCGACGAGATCAAGCAAGCGTTCTTCGCGGGCGGCGGCGC
GCAGCCGCAGGTCGCCTTCACTGTCTCGATCCCACTGCAGGCGTCAATCAGCCGGCTGCAACTGGAGGTG
GATGGGCAAACCCTGGACGTGCGCGAGGGCGCGCGTGCCAGCCAGTCGATGACCTGGCCTGGACCCAATC
CGGGCCTGGTGCGTGTCGCGGCGTGGGACGCCAGCGGGCAGGCCTTGCCGGTGCTCGAATACCGCGGTCC
CTGGGCCTGGTTTCGGGCGCTGCAGGCCGGGCGGCTGCGCCGCAGCGGCGATCTGGACTACACCGCCAGC
CTCGCCCTGGCCAGCGCCACGGTACGGATGGACGTCCAGCCGGCGAGCCTGCGGCATCCCTTTGCGGCGT
CGGCCGTGCAGCGGTTCAGTTGCCCATGA
 Primer design