SecReT6
Protein ID: 346726851
SecReT6 ID461
T6SS typei3
Gene symbol-
Locus tagXACM_3986
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]4608901..4612425 [-]
Producthypothetical protein
NoteTssM
UniProt IDG2LYL9
KEGG IDxax:XACM_3986
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.60E-91, Aligned region: 189..451
ImcF-related_N [PF14331], Evalue: 2.60E-91, Aligned region: 887..938
IcmF-related [PF06761], Evalue: 4.60E-68, Aligned region: 502..800
DUF1215 [PF06744], Evalue: 4.10E-29, Aligned region: 916..1038
AAA_22 [PF13401], Evalue: 3.50E-05, Aligned region: 127..264
AAA_22 [PF13401], Evalue: 3.50E-05, Aligned region: 429..481
AAA_33 [PF13671], Evalue: 0.0065, Aligned region: 128..243
AAA_16 [PF13191], Evalue: 0.0067, Aligned region: 118..245
AAA_16 [PF13191], Evalue: 0.0067, Aligned region: 589..589
AAA_16 [PF13191], Evalue: 0.0067, Aligned region: 758..892
AAA_16 [PF13191], Evalue: 0.0067, Aligned region: 876..944
Protein Sequence: 1174 a.a.     [Download]
>gi|346726851|ref|YP_004853520.1| hypothetical protein XACM_3986 [Xanthomonas axonopodis pv. citrumelo F1]
MKTLLSKLSATVVVGLLALCLLSVLLWVGGPYVALAGWSPLSSVAARLLAIVLLVVAWVGVLALRRWRTQ
ARAATLSSALAAPGRDDDRELRSGQERAQLQARFQQAIQLLRKRRGGADLYTLPWYALIGPPGSGKSTLL
QHSGLQFPLAARMGDAALRGVGGTRDCEWWFTDEAVLLDTAGRYTTQDSDQAVDAGAWRDFLRLLRRYRP
RRPLNGVLVTMSMSDLLLLDDAERDTHMQAIRRRLDELAEQLQASVPVYLIFTKCDLIGGFGEFFDDLTP
AQRNQVWGMTFALAQTLDGQAARRFADEFGVLQQQLSARLFERLHLERDRLRRAAILSFPQQVAALGERA
RQFVEGTFAGNAYGPAPLLRGVYFTSGTQDGTPIDRMMGAVARTFGLEEARVQAPGAQRRTFFVERLLRE
VVLRESGLANTPPTRQRRRAWLQAAAYAGVALLTGAVLAGLGLSYVGNRAYLHQVRAALDARPAVPDPNA
ATGMPEYVARTLQQADATQAVVKVAQQYHAGAPWSLRMGLFQGQAVGEQVQAGYLRQLNATLLPALAVRL
RTGLVDNAQAPQALYYTLKGYLMLGQPQHLDPAQLSALAAIEAAKLFPREPALQQALGAHLQAVLDSPTR
VRALSLDNQRIAQARASLRAADLSTLIYGNLLLTPPDGTPLRLDKALGLLADTFVRRSGTALSTPVPALY
TQPVFAALQRDGIGQAVERFGRDDWVFGGAALDASAKATLVREVGQRYTADYIRYWDALLADLQLRPSAD
LASASATAAKLAGPSSPLRLLLGVVGEHTQAMDRAPPVDPAQRELAAAANSAGTKATAAAAKLPGGAAMS
AALATPAEGGAAAAPAPGAAISEHFLALNALAAGAPGSTPLDHLLSVLDQLGKQLLVISQGGGDAAAANA
QLALARQEMAQLPPPVTDWLQSLAGSSATLMTQGARAALDAQVRQSVGEVCTDFVRGRYPFDPQAQVEIP
LQNFGELFGSGGRLDALYTGTVKPLLDTQSPQWRWKDGPDAVTGAPGLPVQLQLAQRIRQKYFRGGPTPQ
IGFTVLAPTLGEGVTRLTLDIEGQRYDYQPGAAQSMPMIWPGPVPGHVSIAAFGADGVALGTLDYQGDWA
LFRALQAGHLENPSDLRFVARFALGGHDVQVPLRAGNLRHPFLDSDVQHFACGR
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c4612425-4608901 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGAAGACGCTGTTGTCCAAGCTGAGCGCAACGGTAGTGGTTGGCCTGCTGGCGCTGTGCCTGCTGTCGG
TGCTGCTGTGGGTGGGTGGGCCGTATGTGGCGCTGGCCGGCTGGAGCCCGCTGAGCAGCGTGGCGGCGCG
GCTGCTGGCGATCGTGTTGCTGGTGGTGGCGTGGGTGGGCGTGCTGGCGCTGCGCCGCTGGCGCACGCAG
GCACGTGCGGCGACCTTGTCCAGCGCGCTGGCGGCGCCGGGTCGCGACGACGACCGTGAGCTGCGCAGCG
GGCAGGAACGCGCGCAGCTGCAGGCGCGCTTCCAGCAGGCGATCCAGTTGCTACGCAAGCGGCGCGGCGG
CGCCGATCTGTACACGCTGCCGTGGTATGCGCTGATCGGCCCGCCCGGTTCGGGCAAGAGCACCTTGCTG
CAGCATTCGGGCCTGCAGTTTCCGCTGGCTGCGCGCATGGGCGATGCGGCGTTGCGCGGCGTCGGCGGCA
CCCGCGATTGCGAATGGTGGTTCACCGACGAAGCGGTGTTGCTGGACACCGCCGGGCGCTATACCACGCA
GGATTCGGACCAGGCGGTGGATGCCGGCGCGTGGCGCGATTTCCTGCGCCTGTTGCGACGCTATCGCCCG
CGCCGCCCGCTCAACGGCGTGTTGGTGACGATGAGCATGTCGGACCTGTTGCTGCTCGACGATGCCGAGC
GCGACACCCACATGCAGGCGATCCGCCGCCGCCTGGACGAACTGGCCGAGCAGTTGCAGGCCAGCGTGCC
GGTGTATCTGATCTTCACCAAGTGCGATCTGATCGGCGGCTTTGGCGAGTTCTTCGACGATCTGACGCCG
GCGCAGCGCAACCAGGTGTGGGGCATGACGTTTGCGCTGGCGCAGACCCTGGACGGGCAGGCGGCGCGCA
GGTTCGCCGACGAGTTCGGCGTGCTGCAGCAGCAGCTGAGCGCGCGCCTGTTCGAACGCCTGCACCTGGA
ACGCGACCGTCTGCGGCGTGCGGCGATCCTGTCGTTTCCGCAACAGGTTGCCGCACTCGGCGAGCGTGCG
CGGCAATTCGTCGAAGGCACCTTCGCCGGCAATGCGTATGGCCCGGCACCGTTGCTGCGCGGGGTGTATT
TCACCTCTGGCACGCAGGACGGCACGCCGATCGACCGCATGATGGGCGCGGTGGCGCGCACCTTCGGCCT
GGAAGAAGCACGCGTGCAGGCGCCGGGCGCGCAACGGCGCACCTTTTTCGTCGAGCGGCTGCTGCGCGAG
GTGGTGCTGCGCGAATCCGGCCTGGCCAATACCCCGCCCACCCGGCAGCGCCGCAGGGCGTGGTTGCAGG
CCGCCGCGTACGCGGGTGTGGCGCTGCTGACCGGCGCAGTGCTGGCCGGGTTGGGGCTCAGCTACGTGGG
CAACCGTGCGTACCTGCATCAGGTACGCGCTGCGCTGGACGCGCGGCCGGCAGTGCCCGATCCCAATGCC
GCCACCGGCATGCCCGAGTACGTCGCGCGCACCCTGCAGCAAGCCGATGCGACGCAGGCGGTGGTGAAGG
TGGCGCAGCAGTATCACGCCGGCGCGCCGTGGTCGTTGCGCATGGGGTTGTTCCAGGGCCAGGCGGTGGG
CGAGCAAGTGCAGGCCGGCTACCTGCGTCAGCTCAACGCCACCTTGTTGCCGGCCTTGGCGGTGCGCCTG
CGCACCGGTCTGGTCGATAACGCACAGGCACCGCAGGCGCTGTACTACACGCTCAAGGGCTATCTGATGC
TGGGCCAGCCGCAGCATCTGGACCCGGCGCAACTCAGCGCACTGGCCGCCATCGAAGCGGCAAAATTGTT
CCCGCGCGAGCCGGCATTGCAGCAGGCGCTGGGTGCGCATCTGCAGGCCGTGCTCGATTCGCCCACGCGC
GTGCGTGCGCTGTCGCTGGACAACCAGCGCATCGCCCAGGCGCGCGCCAGCCTGCGCGCCGCCGACCTAT
CGACACTGATCTACGGCAACCTGTTGCTGACCCCGCCGGACGGCACGCCGTTGCGGCTGGATAAAGCGCT
GGGCCTGCTGGCCGACACCTTCGTGCGCCGCAGTGGCACGGCGTTGTCCACCCCGGTGCCGGCGCTGTAC
ACCCAGCCGGTATTCGCCGCGTTGCAACGCGATGGCATCGGCCAGGCGGTGGAACGCTTCGGCCGCGACG
ATTGGGTCTTCGGCGGTGCGGCGCTGGATGCGTCCGCCAAGGCCACGCTGGTGCGCGAAGTGGGGCAGCG
CTACACGGCCGATTACATCCGTTACTGGGATGCGTTGCTGGCCGATCTGCAACTGCGCCCGTCGGCCGAT
CTGGCCAGTGCCAGCGCCACGGCCGCCAAGCTGGCCGGGCCCAGTTCGCCGCTGCGGCTGCTGCTGGGCG
TGGTCGGCGAGCACACCCAGGCAATGGACCGCGCACCACCGGTAGACCCCGCGCAGCGCGAGTTGGCGGC
TGCCGCCAACTCGGCAGGCACCAAGGCGACTGCCGCCGCGGCCAAACTCCCCGGCGGGGCGGCGATGAGC
GCCGCGCTGGCCACGCCCGCCGAGGGTGGCGCAGCTGCAGCGCCGGCACCGGGTGCGGCGATCAGCGAGC
ATTTTCTGGCGCTCAACGCCTTGGCCGCAGGCGCGCCTGGCAGCACGCCGCTGGACCATCTGCTGAGCGT
GCTCGATCAGCTCGGCAAGCAATTGCTAGTGATTTCCCAGGGCGGCGGCGATGCCGCGGCGGCCAACGCG
CAACTGGCATTGGCCCGGCAGGAAATGGCGCAACTGCCGCCGCCGGTGACCGACTGGCTGCAGAGCCTGG
CCGGCAGCAGCGCCACCTTGATGACCCAGGGCGCACGCGCCGCGCTGGATGCGCAGGTCAGGCAATCGGT
GGGCGAGGTGTGCACGGATTTCGTGCGCGGCCGCTACCCGTTCGATCCGCAGGCGCAGGTGGAGATCCCG
CTGCAGAATTTCGGCGAGTTGTTCGGTAGCGGCGGCCGTCTGGATGCGCTGTATACCGGCACCGTCAAAC
CGCTGCTGGACACCCAGTCCCCGCAATGGCGCTGGAAGGATGGCCCGGACGCGGTCACCGGCGCGCCCGG
TCTGCCGGTGCAACTGCAACTGGCGCAGCGGATCCGGCAGAAATATTTTCGCGGCGGGCCCACGCCGCAG
ATCGGCTTTACCGTGTTGGCGCCCACGCTGGGCGAAGGCGTGACCCGGCTGACGCTGGATATCGAAGGCC
AGCGCTACGACTACCAGCCCGGCGCGGCGCAAAGCATGCCGATGATCTGGCCCGGCCCGGTGCCGGGGCA
TGTGTCCATCGCCGCCTTCGGCGCCGATGGCGTGGCGCTGGGTACGCTGGACTACCAGGGCGATTGGGCG
CTGTTCCGCGCGCTGCAGGCCGGGCACCTGGAAAACCCGTCGGACCTGCGCTTTGTCGCCCGCTTCGCGC
TTGGCGGCCACGACGTGCAGGTGCCGCTGCGTGCCGGCAACCTGCGCCACCCGTTTCTGGACAGCGACGT
CCAGCACTTCGCGTGCGGCCGATGA
 Primer design