SecReT6
Protein ID: 347538930
SecReT6 ID459
T6SS typei4b
Gene symbolvgrG
Locus tagNH8B_1110
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1131051..1134176 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDG2IZZ2
KEGG IDpse:NH8B_1110
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-68, Aligned region: 47..378
DUF2345 [PF10106], Evalue: 7.50E-51, Aligned region: 715..872
T6SS_Vgr [PF13296], Evalue: 2.60E-36, Aligned region: 449..462
T6SS_Vgr [PF13296], Evalue: 2.60E-36, Aligned region: 556..664
T6SS_Vgr [PF13296], Evalue: 2.60E-36, Aligned region: 741..765
Phage_base_V [PF04717], Evalue: 1.70E-25, Aligned region: 439..539
Sarcoglycan_1 [PF04790], Evalue: 0.00035, Aligned region: 788..853
Protein Sequence: 1041 a.a.     [Download]
>gi|347538930|ref|YP_004846354.1| vgrG gene product [Pseudogulbenkiania sp. NH8B]
MDAVSALELLSSFAAAFSQEQRLLTLHLGDGPRWGETLLPLAVHGDEAVSDSYRYRVECLSPDAGLELKS
LLGVPVRLGLAGADGTEQVRGGVVSAVDSLGADGGFAKYALTVEPPFALLRLRRTSRVFQDLSVPDIVRQ
VFAEHAAANPVFAAVQRLDFVLAGELPSRSYCLQYRESDYDFLVRLLHEEGLAWRFEHGERASEPGRAAS
RGALPQVQLVAFDDPYSPPAAGVERVRFHRSDATEEEDGLTRWDGTRQIVSGGVTLASFDYQPVATGHSG
DSSAVEQGSDGTRLQSSLQDYDVPGPYYAGDADQLAHYARLRQQAHDAQAKRFDGGGSVRGLAAGQWFRL
DDHPAHEGDAPEQREFVVTRQAFTARNNLPTDLARALPPSLRPTSTAGAGADTSASDVPYHTTFSAQRRG
LPLTPAYAGTALAKPTARGAQTATVVGPAGEEIHTDAHGRIKVQFHWQRPDEHPTIGANLDDTSSCWLRV
AMPAAGAGWGHQFIPRIGQEVLVDFLEGDIDRPIITGVLYNGSHPPPAFSGTGNLPANKTLSGIKSKEHQ
GGQYNELLFDDTPGEVRAKLSSEHGATQLNQGYLVHPRADGKATPRGDGFELRTDRHGAIRAGHGLLLST
EAQPSVSGKQLARDGAQSQLDAALSLSQSLGETATAQLADTVEIGPETIQPDNGKGAKKPDGHLQHHVQA
LKAWEAGTNTNKDGKNSPNGAGQAGQQPLMVLSAPAGLAATTDNSLTLAAGTNIDQIAQRDTQQTSGRRW
LHNVGQHISLFVAGVKDAVSLKLIAAKGKVQVQAQSDAMELTADKDVSITSCKGKVLISAKQDILLTSGG
GYIKLSGGNIDIHCPDIVSIKGADHELSGGASQNPILPTLPQSERKNFLELTYAYPDLRPVPGAPFTVHF
ADGTQKQGTLDASGYTKLDNVPEGPISVYYGEDPRPYQPNVTFPSNPITGLPASVSEALSRLEQREKLHD
AFWAQEATTEQRDYIRELNAMTGEHEDPRTPLLDEPAGESLEDFLNESQRTELAAAKEKQV
 
Nucleotide Sequence: 3126 bp     [Download]
>gi|347537839|ref|NC_016002.1|:c1134176-1131051 Pseudogulbenkiania sp. NH8B, complete genome
ATGGATGCCGTGAGCGCCCTTGAACTTCTTTCCAGCTTCGCCGCCGCCTTCAGCCAGGAGCAGCGCCTCC
TCACCCTGCACCTGGGCGACGGCCCGCGCTGGGGCGAGACGCTGCTGCCACTCGCCGTGCACGGCGACGA
GGCGGTCTCCGACAGCTACCGCTACCGCGTCGAGTGCCTGTCGCCCGACGCCGGGCTCGAACTGAAGTCG
CTGCTCGGCGTGCCGGTGCGGCTCGGCCTCGCCGGGGCGGACGGGACCGAGCAGGTGCGCGGCGGTGTGG
TCAGCGCTGTCGACAGCCTGGGGGCCGACGGCGGCTTTGCCAAGTACGCCCTTACCGTCGAACCGCCGTT
CGCGCTGCTGCGCCTGCGCCGTACCTCGCGGGTGTTCCAGGACCTCTCGGTGCCCGACATTGTGCGCCAG
GTGTTCGCCGAACACGCCGCCGCCAACCCGGTGTTCGCGGCGGTGCAGCGTCTCGACTTCGTGCTCGCGG
GCGAGCTGCCCTCCCGCAGTTACTGCCTGCAATACCGCGAGAGCGACTACGACTTCCTCGTGCGCCTGCT
GCACGAGGAAGGGTTGGCCTGGCGCTTTGAGCATGGAGAGAGAGCGAGCGAGCCAGGTCGCGCCGCGTCG
CGAGGGGCTCTCCCGCAGGTCCAGCTCGTCGCCTTCGACGACCCGTATTCGCCGCCGGCCGCCGGGGTGG
AGCGGGTGCGCTTCCACCGCAGCGATGCGACGGAAGAAGAGGATGGCCTCACGCGCTGGGACGGCACGCG
CCAGATCGTTAGCGGCGGCGTGACGCTGGCCAGCTTCGACTACCAGCCTGTCGCCACCGGCCACAGCGGC
GATAGCAGCGCCGTCGAGCAGGGCTCCGATGGGACGCGGTTGCAAAGCAGCCTGCAGGACTACGACGTCC
CCGGCCCCTACTACGCCGGCGACGCCGACCAGCTCGCCCACTACGCCCGGCTGCGCCAGCAGGCGCACGA
CGCGCAGGCCAAGCGCTTCGACGGTGGCGGCTCGGTGCGCGGGCTCGCCGCCGGGCAGTGGTTCCGCCTC
GACGATCACCCGGCGCACGAGGGGGACGCTCCCGAACAGCGCGAATTCGTCGTCACGCGCCAGGCCTTCA
CCGCCCGCAACAACCTACCGACCGACCTGGCACGGGCGCTGCCGCCCAGCCTTCGGCCAACCTCGACCGC
CGGCGCGGGGGCCGACACCTCGGCAAGCGACGTTCCGTACCACACCACCTTCAGCGCCCAGCGCCGCGGC
CTGCCGCTCACCCCGGCCTACGCCGGCACCGCGCTGGCCAAGCCCACCGCGCGCGGCGCCCAGACCGCCA
CCGTGGTCGGGCCTGCGGGGGAAGAGATCCACACCGACGCCCACGGCCGCATCAAGGTCCAGTTCCACTG
GCAGCGTCCCGACGAACACCCGACGATCGGCGCCAACCTCGACGACACCTCCAGCTGCTGGCTGCGCGTC
GCCATGCCCGCGGCCGGCGCCGGCTGGGGCCACCAGTTCATCCCGCGTATCGGCCAGGAAGTGCTGGTCG
ACTTCCTCGAAGGCGACATCGACCGCCCGATCATCACCGGCGTGCTGTACAACGGCAGCCACCCGCCGCC
CGCCTTCAGCGGCACCGGCAACCTGCCGGCCAACAAGACCCTGTCCGGCATCAAGTCGAAAGAGCACCAG
GGCGGCCAGTACAACGAACTCTTGTTCGACGACACCCCCGGCGAAGTGCGCGCCAAACTGTCGTCCGAAC
ACGGCGCCACCCAGCTCAACCAGGGCTACCTCGTCCACCCGCGTGCCGACGGCAAGGCCACGCCCCGCGG
CGACGGCTTCGAACTGCGCACCGACCGCCATGGCGCGATCCGCGCCGGCCACGGCCTGCTGCTCAGCACC
GAAGCGCAGCCCTCCGTCTCCGGCAAACAACTGGCGCGCGACGGCGCGCAAAGCCAGCTTGATGCGGCCC
TGAGCCTGAGCCAGTCCCTCGGCGAGACCGCTACCGCACAGCTGGCCGATACCGTTGAAATCGGGCCGGA
GACGATTCAGCCGGACAACGGCAAGGGAGCGAAGAAGCCCGACGGACACCTGCAGCACCACGTCCAAGCG
CTGAAGGCCTGGGAAGCCGGAACCAATACCAATAAAGATGGCAAAAACTCCCCCAACGGCGCGGGACAGG
CAGGCCAACAACCGCTGATGGTCCTGTCCGCCCCGGCCGGCCTCGCCGCAACCACCGACAACAGCCTCAC
CCTGGCGGCTGGGACGAATATCGACCAAATCGCCCAGCGCGATACCCAACAGACCTCGGGCCGGCGCTGG
CTGCACAACGTGGGGCAGCACATCAGCCTGTTCGTCGCCGGAGTGAAGGACGCGGTGAGTCTGAAACTGA
TCGCCGCCAAGGGCAAGGTGCAGGTCCAGGCGCAAAGCGATGCGATGGAGCTGACGGCGGACAAAGATGT
AAGCATCACCTCCTGCAAGGGCAAGGTGCTAATCAGCGCCAAGCAGGACATCCTGCTCACCAGCGGCGGC
GGCTACATCAAGCTGTCCGGCGGCAACATCGACATCCACTGCCCGGATATCGTCAGCATCAAAGGGGCGG
ACCATGAATTGAGTGGCGGGGCAAGCCAAAACCCGATACTGCCAACGCTGCCGCAATCCGAACGCAAGAA
TTTCCTGGAGCTTACCTATGCTTACCCGGACTTGCGTCCGGTCCCAGGCGCACCGTTCACGGTGCACTTT
GCGGATGGGACCCAAAAGCAGGGAACACTAGATGCCAGCGGCTATACCAAGCTGGACAACGTACCCGAAG
GACCAATCAGCGTGTACTACGGGGAAGATCCGCGACCGTATCAACCCAATGTCACCTTCCCGTCCAATCC
GATAACCGGGCTCCCCGCATCAGTCAGCGAAGCCCTGTCACGACTCGAGCAGCGCGAAAAGCTCCATGAC
GCATTTTGGGCCCAGGAGGCCACCACGGAGCAGCGTGACTACATCCGCGAACTGAATGCCATGACTGGAG
AACACGAAGACCCACGCACCCCCCTATTGGACGAACCGGCAGGCGAATCGCTGGAAGACTTCCTCAATGA
GTCACAGCGCACAGAGCTGGCCGCGGCCAAGGAGAAGCAGGTATGA
 Primer design