SecReT6
Protein ID: 347538931
SecReT6 ID459
T6SS typei4b
Gene symbol-
Locus tagNH8B_1111
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1134183..1134671 [-]
Producthypothetical protein
NoteTagL
UniProt IDG2IZZ3
KEGG IDpse:NH8B_1111
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 9.60E-07, Aligned region: 76..147
Protein Sequence: 162 a.a.     [Download]
>gi|347538931|ref|YP_004846355.1| unnamed protein product [Pseudogulbenkiania sp. NH8B]
MFYKIASLAICASLLMGCAGTKQAAQNAAMNAAAAQDPQGKTIVAKVTAELDQATTKVIEETGNKTIAKD
PTLIPFEKMSSKLTPVTEQQVRALAPALVIAKQIVVTGFCNGREVGNASSAARARAMVVKSLLVESGISS
IRITVRADTKQKLHAVRISFNG
 
Nucleotide Sequence: 489 bp     [Download]
>gi|347537839|ref|NC_016002.1|:c1134671-1134183 Pseudogulbenkiania sp. NH8B, complete genome
ATGTTTTACAAAATTGCCTCTCTCGCTATTTGTGCCTCCCTGCTCATGGGCTGTGCCGGAACCAAGCAGG
CGGCTCAAAATGCGGCAATGAATGCGGCCGCGGCACAAGACCCGCAAGGAAAGACTATTGTGGCCAAGGT
CACGGCGGAACTGGACCAGGCCACCACGAAAGTCATTGAGGAAACCGGCAACAAAACCATCGCCAAAGAC
CCGACTCTGATTCCCTTCGAGAAGATGAGCTCGAAGCTGACCCCGGTTACCGAGCAGCAAGTACGCGCCC
TGGCACCGGCTCTGGTCATCGCCAAACAAATCGTCGTCACCGGCTTTTGTAATGGACGTGAGGTTGGCAA
TGCCTCTTCTGCCGCCAGAGCCAGGGCGATGGTCGTGAAAAGCCTGCTGGTCGAAAGCGGCATCTCGTCC
ATACGAATTACCGTCCGTGCCGACACCAAGCAAAAACTGCATGCCGTTCGTATCTCGTTCAACGGTTGA
 Primer design