SecReT6
Protein ID: 347538932
SecReT6 ID459
T6SS typei4b
Gene symbolhcp
Locus tagNH8B_1112
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1134739..1135236 [-]
Producttype VI secretion system effector
NoteTssD
UniProt IDG2IZZ4
KEGG IDpse:NH8B_1112
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.20E-50, Aligned region: 6..139
Protein Sequence: 165 a.a.     [Download]
>gi|347538932|ref|YP_004846356.1| hcp gene product [Pseudogulbenkiania sp. NH8B]
MAFDAFLKIDGIPGESTDDQHKDWIEIQSFSHLIEQPAQATASSAGGATAERVNHGVYEITHFLDKASPK
IYEACCTGKHIKDVTIELCRAGGDKVKYMEIKMEQVLVSKVEPNGSANDAGFPSEKVSFSYGKIKWTYTQ
QKRADGAGGGNVSAGWDLTANKVIA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|347537839|ref|NC_016002.1|:c1135236-1134739 Pseudogulbenkiania sp. NH8B, complete genome
ATGGCTTTTGACGCCTTCCTGAAAATCGACGGAATTCCAGGGGAAAGCACCGACGATCAACACAAAGACT
GGATCGAAATCCAGTCCTTCTCCCACCTGATCGAGCAGCCGGCCCAGGCCACCGCCAGCTCAGCCGGTGG
CGCCACTGCCGAACGCGTCAACCACGGCGTGTACGAAATCACCCACTTCCTAGATAAGGCCAGCCCGAAG
ATCTACGAAGCATGCTGCACCGGCAAGCACATCAAGGACGTCACCATCGAGCTGTGCCGCGCGGGCGGCG
ACAAAGTGAAGTACATGGAGATCAAGATGGAACAGGTGCTGGTCTCCAAGGTCGAGCCGAACGGCTCGGC
CAACGATGCCGGCTTCCCCAGCGAGAAGGTCAGCTTTAGCTACGGCAAGATCAAGTGGACCTACACCCAG
CAGAAACGTGCCGACGGCGCCGGTGGCGGCAATGTCAGCGCAGGCTGGGATCTGACCGCCAATAAAGTCA
TCGCTTAA
 Primer design