SecReT6
Protein ID: 347538933
SecReT6 ID459
T6SS typei4b
Gene symbolimpC
Locus tagNH8B_1113
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1135340..1136824 [-]
Producttype VI secretion protein EvpB/ImpC
NoteTssC
UniProt IDG2IZZ5
KEGG IDpse:NH8B_1113
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.70E-193, Aligned region: 67..490
DUF3386 [PF11866], Evalue: 0.00037, Aligned region: 51..126
DUF3386 [PF11866], Evalue: 0.00037, Aligned region: 134..150
Protein Sequence: 494 a.a.     [Download]
>gi|347538933|ref|YP_004846357.1| impC gene product [Pseudogulbenkiania sp. NH8B]
MNSVQQLDTAASPNVVDAGSLLDSIIEQSRIATNDSEKNHTRDLIGELVAQVLEGCVTVSRDLSASIDAR
IAELDALLSSQLNEVMHHPEFQKLEASWRGLKYLVAESETSTMLKIKVLNASKKDLVKDFKASPEFDQSA
LFKKIYEEEYGTFGGAPYAALVGDYEFTRHPEDFYLLDELSHVAASAHAPLISSASPGLFGLESFTDIGK
PRDLAKIFDTVEYAKWKSFRESEDSRYVGLVLPHVLGRLPYGRDNVPVEAFDFEENVDGSHHGKYLWTNA
AYAYAARLTDAFAQYGWLAAIRGVEGGGLVEGLPAHTFKTDDGEVALKCPTEVAVTDRTEKLLSDLGFIS
LVHCKNTDYAAFFSGQSVQKAKTYNTDAANANARLSTQLPYIFAVSRIAHYMKSIMRDKIGSFASRQNVQ
DFLNTWLAQYVLLDDSASQEAKAKYPLREARVDVVEVPGKPGVYRAAAFLRPHFQLDELTISLRLVAELP
QPAG
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|347537839|ref|NC_016002.1|:c1136824-1135340 Pseudogulbenkiania sp. NH8B, complete genome
ATGAACAGCGTACAACAACTGGACACGGCGGCGAGCCCGAATGTCGTCGATGCCGGTAGTCTGCTGGACA
GCATCATCGAGCAGAGCCGCATCGCCACCAACGACAGCGAAAAAAACCATACCCGCGACCTGATCGGCGA
ACTGGTGGCCCAGGTGCTGGAAGGCTGCGTGACCGTATCGCGCGATCTGTCCGCCAGCATTGATGCCCGC
ATCGCCGAGCTGGACGCCCTGCTGTCGTCCCAGCTCAACGAGGTGATGCACCACCCCGAGTTCCAGAAGC
TGGAAGCCTCGTGGCGCGGCCTCAAGTATCTGGTGGCGGAATCGGAAACCAGCACCATGCTGAAGATCAA
GGTGCTCAATGCCTCCAAGAAGGATCTGGTGAAGGACTTCAAGGCCTCGCCGGAGTTCGATCAGAGCGCC
TTGTTCAAGAAGATCTACGAGGAAGAGTACGGCACCTTCGGTGGCGCACCCTACGCCGCCCTGGTGGGCG
ACTACGAATTCACCCGCCACCCGGAAGACTTCTACCTGCTGGATGAGCTGTCCCATGTTGCAGCCTCGGC
GCATGCCCCACTGATCTCCTCCGCCTCCCCCGGCCTGTTCGGCTTGGAAAGCTTTACCGACATTGGCAAA
CCACGCGATCTGGCCAAGATCTTCGACACCGTGGAATACGCCAAGTGGAAGTCTTTCCGCGAATCCGAAG
ATTCGCGCTACGTCGGCCTGGTACTGCCGCATGTGCTCGGCCGCCTGCCATATGGCCGCGACAACGTGCC
GGTAGAAGCATTCGACTTTGAAGAAAACGTCGACGGCAGCCATCACGGCAAATACCTGTGGACCAACGCT
GCTTATGCCTACGCCGCACGCCTGACCGATGCCTTCGCCCAGTACGGCTGGCTGGCGGCGATCCGTGGTG
TGGAAGGCGGTGGCCTGGTTGAAGGACTGCCCGCACACACCTTCAAGACCGATGACGGCGAGGTGGCGCT
CAAGTGCCCCACCGAAGTGGCCGTCACCGATCGCACCGAAAAGCTGCTGTCGGACCTTGGCTTCATCTCG
CTGGTGCACTGCAAAAACACCGACTACGCCGCCTTCTTCAGCGGCCAATCGGTGCAGAAAGCCAAGACCT
ACAACACCGATGCGGCCAACGCCAACGCACGCCTCTCCACTCAGCTGCCCTACATCTTCGCCGTATCGCG
CATTGCGCATTACATGAAATCCATCATGCGCGACAAGATCGGCAGCTTTGCCTCACGCCAAAACGTGCAG
GACTTCCTGAACACCTGGTTGGCGCAGTACGTGTTGCTGGACGACTCCGCCAGCCAGGAAGCCAAGGCTA
AATACCCGCTGCGGGAGGCCCGTGTAGACGTGGTGGAAGTCCCTGGCAAGCCGGGCGTCTATCGCGCCGC
GGCCTTCCTGCGCCCGCATTTCCAGCTGGATGAACTCACCATTTCCCTGCGTTTGGTTGCCGAGCTGCCT
CAGCCGGCAGGCTAA
 Primer design