SecReT6
Protein ID: 347538934
SecReT6 ID459
T6SS typei4b
Gene symbolimpB
Locus tagNH8B_1114
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1136828..1137340 [-]
Producttype VI secretion protein ImpB
NoteTssB
UniProt IDG2IZZ6
KEGG IDpse:NH8B_1114
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.20E-59, Aligned region: 10..164
Protein Sequence: 170 a.a.     [Download]
>gi|347538934|ref|YP_004846358.1| impB gene product [Pseudogulbenkiania sp. NH8B]
MSKESTQKKLSRVRPPRVQITYDVEIGDAIETKELPFVLGVLGDYSGHSKNPLPKMKERKFVQIDRDNFD
EVLKGMAPRLAIKVDNKLEDDNSQLAMELNFNELADFEPQSVVTQVEPLKRLLEARTRLADLRNKLAGND
KLEELLDEVVRDTEKLRQISQATQSDNTGE
 
Nucleotide Sequence: 513 bp     [Download]
>gi|347537839|ref|NC_016002.1|:c1137340-1136828 Pseudogulbenkiania sp. NH8B, complete genome
ATGAGCAAAGAAAGCACCCAGAAAAAACTGTCGCGGGTCCGCCCCCCGCGTGTGCAGATCACTTACGACG
TCGAAATCGGCGACGCCATCGAGACCAAGGAACTGCCCTTCGTGCTAGGCGTGCTGGGCGACTATTCCGG
TCACAGCAAGAATCCGCTGCCCAAGATGAAGGAGCGCAAGTTCGTGCAGATCGACCGCGACAACTTCGAC
GAAGTCCTCAAGGGCATGGCACCGCGCCTGGCTATCAAGGTCGACAACAAGCTGGAAGACGACAACAGCC
AATTGGCGATGGAGCTGAACTTCAACGAGCTGGCCGATTTCGAGCCGCAGAGCGTGGTGACTCAGGTGGA
ACCGCTCAAGCGGCTACTGGAAGCCCGCACCCGCCTGGCCGACCTGCGCAACAAGCTGGCCGGCAACGAC
AAGCTGGAAGAGCTGTTGGACGAGGTGGTGCGTGACACCGAGAAACTGCGCCAGATCAGCCAAGCCACCC
AAAGCGACAACACCGGAGAGTAA
 Primer design