SecReT6
Protein ID: 347538936
SecReT6 ID459
T6SS typei4b
Gene symbolicmF
Locus tagNH8B_1116
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1138416..1142375 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDG2IZZ8
KEGG IDpse:NH8B_1116
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.50E-72, Aligned region: 184..441
ImcF-related_N [PF14331], Evalue: 3.50E-72, Aligned region: 463..499
IcmF-related [PF06761], Evalue: 2.30E-41, Aligned region: 487..555
IcmF-related [PF06761], Evalue: 2.30E-41, Aligned region: 690..938
IcmF-related [PF06761], Evalue: 2.30E-41, Aligned region: 1022..1135
DUF1215 [PF06744], Evalue: 5.90E-27, Aligned region: 1060..1174
Protein Sequence: 1319 a.a.     [Download]
>gi|347538936|ref|YP_004846360.1| icmF gene product [Pseudogulbenkiania sp. NH8B]
MLKKGWRRYAKVASAIGFLILIALIWFLGEWMGLETLEARLSCIVVIMLLWVASLLIGQLLARRAGGLLE
KMLRQQADDAVIHAGSDKRAEVTLLRQRLLAAIDTLKKSKLGNSSGNAALYELPWYMIIGHPAAGKSSAI
LQSGLTFPFSDKSGIQGVGGTRNCDWFFSTEGVLLDTAGRYATQSEDRGEWLAFLKLLKKHRTKAPVNGI
LVAISLPELAQHHSEGFSLYVRQVRERIHEVCSTFELHVPVYLVFTKLDLLGGFAEFFQDMPEEERARVW
GCTLTAHQGNGFDASTVAAQQFELLHCGLVQAGEEKLLQYRGDQVRPAHFAFPIEFHGLKEAVVKFVTLL
YEDDPYHARPLLRGFYFTSALQEGTPRIVAANRVQGQFDLVARQGDKRQAPASYSFFLGDLFRKVLFPDQ
HLISRQTRHSGSRWRMAAMAAGVLTLSVLAGLWSWSYIGNQQLLAEISQEREAARKLAASGQLYDKLRAL
QQLQTRLEQLQAYRTEGAPWQIGVGLYQGKPLEAALRSEYFAGIKTLMLIPVQRNLETSLLALDQRQPVP
PPAAQEAKPVAPTPSPVTTPTKPKPQYRPRLQGKPLPNIQLGVIREEYRGRPVPLSSDDYHVRTTLWPHH
ALQPVATNWQTAGFGLRRASWTSPVRVAAVQPSAAPVAAATQAVAAATEASAERPTQAPAKSPQLDASYN
ALKTYLMLYQPQRMEPAHLADQLPRYWRPYLEAQRGQYSTEEIMTVAEKLLAFYISQLKAPDLPLISPNL
RVVNQAREVLRGSFKRMSAEERVFNEIRARANTRFAPLTVARILNNRDLDIMAGSQMVEGAFTREAWDQY
VKGAIEEASKGEIRSDDWVLAATSQDNLGKDGDGEKNRTALEAQYRAAYIDSWKRFLQGVTVRDFTSPAQ
SASAMTRLSDRETSPIKLILVRAAMETAWDNPSELNRSLEHAKQSVLEKTAALLKGGSGENTPKDKLYGE
VGRQFAGVAQLVKGDNAPINGYLEQLAKLKAKLGAIASTDDPGSLARATLQATFNNNGSELADSIAYVDN
ALLAQSTPDTVSLVRPMLVRPLSHSYSALLGPVSADINQAWATEVLPQWRQLAAKYPFSDAGNTASIAEI
NRFLKANDGTLDRFINKYLAGLVQKKGDMLVPRAWGELGIKFNPAFLSSVSSLSALANGPLQEGDSLRFE
LQPQPTPGLSEIFFDIDGQELRYRNGPQIWQTFTWSGNSQTAGARIQVLSYTGASNVVANHPGGMGLMRL
LAGAKVVQDGSDGTQLVWTLRKADGDTQSVRVNFRVLSGVNPLQLARLNKLTLPERVTL
 
Nucleotide Sequence: 3960 bp     [Download]
>gi|347537839|ref|NC_016002.1|:c1142375-1138416 Pseudogulbenkiania sp. NH8B, complete genome
GTGTTGAAAAAAGGTTGGCGTCGCTATGCCAAGGTGGCATCGGCGATCGGATTCCTGATCCTGATCGCCC
TGATCTGGTTCCTGGGTGAATGGATGGGGCTGGAAACCCTAGAGGCCCGGCTAAGTTGCATCGTCGTGAT
CATGCTGCTCTGGGTGGCCAGCCTACTGATCGGGCAACTTCTGGCCCGGCGCGCCGGCGGACTGCTGGAG
AAAATGCTGCGCCAGCAGGCTGACGATGCCGTGATCCACGCCGGCTCCGACAAGCGCGCCGAAGTCACCC
TGCTGCGCCAGCGACTACTGGCCGCCATCGACACCCTGAAGAAGTCGAAACTCGGCAACAGCAGTGGCAA
TGCGGCACTGTATGAGCTGCCCTGGTACATGATCATCGGCCACCCTGCCGCCGGCAAAAGCTCGGCCATC
CTGCAGTCCGGCCTCACCTTCCCCTTCAGCGACAAGAGTGGCATCCAGGGGGTCGGCGGCACGCGCAACT
GCGACTGGTTCTTCTCCACCGAAGGGGTGCTGCTCGATACCGCCGGCCGCTACGCGACCCAGAGCGAGGA
TCGAGGCGAGTGGCTCGCTTTTCTGAAACTGCTGAAAAAACATCGTACCAAAGCGCCAGTGAACGGCATC
CTGGTCGCCATCAGCCTGCCCGAACTGGCCCAGCACCACAGCGAAGGCTTTTCGCTGTATGTCCGTCAGG
TACGGGAACGCATCCACGAGGTCTGCAGCACGTTCGAGCTGCACGTCCCCGTCTACTTGGTGTTTACCAA
ACTGGATCTGCTGGGTGGATTCGCCGAGTTCTTCCAGGACATGCCGGAAGAAGAGCGCGCCAGGGTGTGG
GGCTGCACGCTGACAGCCCACCAGGGCAACGGCTTCGATGCCTCCACCGTCGCCGCCCAGCAATTCGAGT
TGCTTCACTGCGGTCTGGTGCAGGCCGGCGAGGAGAAGTTACTGCAATATCGCGGCGATCAGGTTCGTCC
GGCACACTTCGCTTTCCCGATCGAGTTTCACGGCCTGAAAGAAGCCGTCGTGAAATTCGTAACTCTGCTG
TACGAGGACGACCCCTATCACGCCCGCCCCCTGCTACGCGGCTTCTACTTTACCAGCGCGCTGCAGGAAG
GCACGCCGCGTATCGTGGCGGCCAACCGGGTTCAGGGTCAGTTCGACCTGGTTGCAAGACAGGGCGACAA
ACGTCAGGCCCCGGCCTCGTATAGCTTTTTCCTGGGCGACCTGTTTCGCAAGGTACTGTTTCCGGACCAG
CACCTGATCTCCCGGCAGACCCGGCACAGCGGCAGCCGCTGGCGCATGGCAGCCATGGCGGCCGGCGTGC
TGACGCTCAGCGTACTGGCAGGCCTGTGGAGCTGGTCCTACATCGGCAACCAGCAACTGCTGGCGGAAAT
CAGCCAGGAACGGGAAGCCGCCCGCAAGCTGGCGGCTTCCGGCCAACTGTACGACAAGCTGCGCGCACTG
CAGCAGTTGCAAACCCGCCTGGAGCAGTTGCAGGCGTACCGTACCGAAGGTGCCCCTTGGCAGATCGGCG
TGGGTCTTTATCAGGGCAAGCCGCTGGAAGCCGCATTGCGCAGCGAATACTTTGCCGGCATCAAGACCCT
GATGCTGATACCGGTTCAGCGCAACCTGGAAACCTCCCTGCTCGCGCTCGACCAGCGGCAGCCGGTGCCT
CCGCCCGCGGCACAGGAAGCCAAGCCAGTTGCGCCAACGCCCTCCCCTGTGACCACGCCGACAAAACCCA
AGCCCCAATACCGCCCTCGGCTGCAAGGCAAGCCGCTGCCGAACATTCAATTAGGCGTCATTCGCGAAGA
ATACCGGGGACGCCCAGTGCCCCTATCGAGCGACGACTACCACGTTCGGACTACCCTCTGGCCACACCAT
GCCCTGCAGCCTGTGGCGACAAACTGGCAGACAGCCGGCTTCGGTCTGCGCCGAGCCAGTTGGACATCAC
CGGTTCGCGTCGCGGCAGTCCAGCCGTCGGCAGCCCCAGTGGCCGCGGCCACGCAAGCCGTCGCGGCCGC
CACGGAAGCATCCGCGGAGCGCCCGACCCAGGCCCCGGCCAAATCGCCACAGCTGGATGCCAGCTACAAC
GCGCTGAAAACCTATCTGATGCTGTACCAGCCTCAGCGCATGGAGCCGGCACACCTGGCGGACCAACTGC
CACGCTACTGGCGCCCCTATCTGGAAGCCCAGCGCGGGCAATACAGCACCGAAGAGATCATGACGGTCGC
CGAAAAGCTGCTGGCGTTCTACATCAGCCAGCTAAAGGCACCGGACCTGCCACTGATTTCGCCCAACCTG
CGCGTGGTCAACCAGGCACGCGAGGTGCTGCGCGGCTCTTTCAAGCGCATGTCGGCCGAAGAGCGGGTAT
TCAATGAAATCCGCGCTCGAGCCAACACCCGCTTTGCACCGCTGACCGTAGCCCGCATTCTCAACAACCG
CGACCTGGACATCATGGCAGGCAGCCAGATGGTGGAAGGCGCGTTTACTCGCGAGGCATGGGATCAGTAC
GTGAAAGGCGCCATCGAGGAGGCGAGCAAGGGCGAAATCCGCAGCGACGACTGGGTACTGGCAGCCACCA
GCCAGGACAACCTGGGCAAGGATGGCGACGGCGAGAAAAACCGCACCGCACTGGAGGCACAATACCGCGC
CGCCTATATCGACAGCTGGAAACGCTTCCTGCAGGGTGTCACGGTGCGCGATTTCACCAGCCCGGCACAG
TCCGCTTCGGCCATGACTCGCCTGTCTGACCGGGAAACCTCGCCCATCAAGCTGATCCTGGTACGAGCGG
CGATGGAAACGGCATGGGACAACCCGTCCGAGCTCAACCGTTCGCTGGAGCATGCCAAGCAGTCGGTGCT
GGAAAAAACCGCTGCGCTGCTGAAAGGCGGCAGCGGCGAGAACACGCCCAAGGACAAGCTCTACGGCGAA
GTGGGCCGGCAGTTTGCCGGGGTGGCCCAGTTGGTGAAAGGCGACAACGCCCCGATCAATGGCTACCTGG
AGCAACTGGCCAAACTGAAAGCCAAGCTGGGTGCCATTGCCAGCACCGACGACCCGGGCTCCCTGGCACG
TGCCACTCTGCAGGCCACCTTCAATAACAACGGCTCGGAACTGGCAGACAGCATCGCCTATGTCGACAAC
GCCTTGCTGGCGCAAAGCACGCCCGACACCGTCAGCCTAGTGCGTCCGATGCTGGTGCGGCCGCTCAGTC
ACTCCTACAGCGCCCTGCTCGGCCCTGTCAGTGCCGACATCAATCAGGCCTGGGCCACGGAGGTCCTGCC
GCAATGGCGCCAGCTGGCGGCCAAATACCCGTTCAGCGATGCCGGCAACACGGCCTCTATTGCCGAGATC
AACCGTTTCCTGAAGGCCAACGACGGCACGCTGGATCGCTTCATCAACAAATACCTGGCCGGCCTGGTCC
AGAAAAAAGGCGACATGCTGGTGCCACGCGCCTGGGGCGAACTGGGTATCAAGTTCAACCCGGCCTTCCT
CAGCAGTGTAAGCAGCCTGTCCGCACTGGCCAACGGCCCGTTGCAGGAGGGTGACAGCCTCCGTTTCGAG
CTGCAACCGCAACCGACGCCGGGGCTCTCAGAGATCTTCTTCGATATCGATGGTCAGGAACTGCGTTATC
GCAATGGCCCGCAAATCTGGCAGACCTTCACTTGGAGCGGCAACAGCCAGACGGCCGGCGCGCGCATCCA
GGTGCTGTCCTACACCGGCGCCAGCAACGTGGTGGCCAACCACCCGGGCGGCATGGGCCTGATGCGCCTG
CTGGCCGGAGCCAAAGTCGTACAGGATGGCTCGGATGGCACCCAGCTAGTCTGGACGCTGCGCAAGGCCG
ACGGGGATACGCAGAGTGTGCGTGTCAATTTCCGGGTACTCAGCGGCGTCAACCCGCTGCAGTTGGCCCG
TCTTAACAAGCTGACGTTGCCCGAGCGCGTAACGTTGTAA
 Primer design