SecReT6
Protein ID: 347538938
SecReT6 ID459
T6SS typei4b
Gene symbollip
Locus tagNH8B_1118
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1143417..1143953 [+]
Producttype VI secretion lipoprotein, Lip family
NoteTssJ
UniProt IDG2J000
KEGG IDpse:NH8B_1118
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.20E-31, Aligned region: 24..154
Protein Sequence: 178 a.a.     [Download]
>gi|347538938|ref|YP_004846362.1| lip gene product [Pseudogulbenkiania sp. NH8B]
MQHCKAGLWRHARGFLGGLVPAVLLISGCASNKEVQVSGEAAAQLNRDGRGKPLSVVVRVYQLKSDQAFN
RLSMEALATAKSDKELLASELLDMREMTLLPGTRVTVSGFVVNPEASHIGLVALFRQPDRHFWRLLYDAD
VVRSKGLQFAAEDCYLRAVKPPPKLLPGQPKSLQVDCR
 
Nucleotide Sequence: 537 bp     [Download]
>gi|347537839|ref|NC_016002.1|:1143417-1143953 Pseudogulbenkiania sp. NH8B, complete genome
ATGCAGCATTGCAAGGCCGGGTTGTGGCGTCATGCCAGGGGGTTTCTGGGGGGGCTGGTGCCTGCCGTAT
TGCTCATATCCGGGTGTGCTTCGAACAAGGAAGTACAAGTGTCCGGCGAAGCCGCTGCGCAGCTGAACCG
CGATGGTCGCGGCAAGCCTCTGTCGGTCGTGGTGCGGGTCTATCAGCTGAAGTCGGATCAGGCGTTCAAC
CGCTTGAGCATGGAGGCGCTGGCGACTGCCAAGTCGGACAAGGAGTTGCTGGCATCCGAACTGCTCGACA
TGCGCGAGATGACGCTGCTGCCGGGTACGCGCGTTACGGTGTCCGGTTTCGTGGTGAACCCCGAGGCCTC
GCACATTGGCCTGGTGGCCCTGTTCCGCCAGCCGGACCGGCATTTCTGGCGCTTGCTGTACGACGCCGAT
GTCGTGCGCAGCAAGGGGCTGCAGTTCGCGGCGGAAGACTGTTACCTGCGTGCCGTCAAGCCTCCGCCAA
AGCTGTTGCCGGGGCAGCCCAAGTCGCTGCAGGTCGATTGCCGCTAG
 Primer design