SecReT6
Protein ID: 347538939
SecReT6 ID459
T6SS typei4b
Gene symbolimpJ
Locus tagNH8B_1119
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1144031..1145377 [+]
Producttype VI secretion protein ImpJ
NoteTssK
UniProt IDG2J001
KEGG IDpse:NH8B_1119
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.20E-122, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|347538939|ref|YP_004846363.1| impJ gene product [Pseudogulbenkiania sp. NH8B]
MQQAKRVLWGEGMFLRPQHFQQQTLFLEQDAVSRQQLLCRHTWGVQQLRLDEQALKGGMVRVDALGILFR
DGLLYQAPQSSPLPLSRDLSTLPQLGVATTLYACLADLQAYGGNARTGEQAGRPSRYQNGGLELADLYTQ
ALPAEVATLEPDVRLMFEEENRDGYDAIPLCRLQKDATGQWGVAGDFLPPLLTIGAAGELPQLVRRLLDI
LLVKSQALTGAQRERAKSVMEFGSSDISAFWLLHTVNRNFARLRHLSLSNPLHPEELYMALAEFCGELQT
FSTRYALVDIPAYRHDALHAVFAALDLQIRELLETVISARYVVIPLHSPKPSFHIGRLESDRLLDNVDFY
LSVQSEQPASQVIDNVPLKFKIGAPDDVEKILNSAMRGVALSHAAQTPSAVPVRVGNHYFSLQPHGDIFA
RMLQSRSICIYVPQTLSGLALELIAVFR
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|347537839|ref|NC_016002.1|:1144031-1145377 Pseudogulbenkiania sp. NH8B, complete genome
ATGCAACAAGCTAAACGTGTGTTGTGGGGCGAAGGCATGTTTCTGCGCCCGCAGCATTTCCAGCAGCAAA
CGCTGTTTCTCGAGCAAGATGCCGTCAGCCGCCAGCAGTTGCTGTGCCGTCATACGTGGGGTGTACAGCA
ACTGCGGCTGGACGAACAGGCGCTGAAGGGGGGCATGGTGCGGGTGGATGCCCTGGGCATCCTGTTTCGC
GATGGCCTGCTCTATCAGGCCCCGCAGTCCTCGCCATTGCCTTTGTCCCGGGACCTCTCGACCCTACCGC
AACTGGGCGTGGCCACGACGCTGTATGCCTGCCTGGCCGATCTGCAGGCCTATGGCGGCAATGCCCGCAC
TGGCGAGCAGGCCGGCAGGCCTAGCCGTTATCAGAATGGCGGCTTGGAGCTAGCCGATCTCTACACCCAG
GCGCTCCCGGCCGAAGTGGCGACACTGGAGCCCGACGTGCGCCTGATGTTCGAAGAAGAGAACCGCGATG
GCTACGATGCCATTCCACTGTGCCGTCTGCAGAAGGATGCCACCGGCCAGTGGGGCGTGGCGGGCGATTT
CCTGCCGCCGCTGCTGACCATCGGTGCGGCGGGAGAACTGCCGCAGTTGGTGCGGCGCCTGCTGGATATC
CTGCTGGTGAAAAGCCAGGCGTTGACGGGGGCACAGCGCGAGCGAGCCAAGAGCGTGATGGAATTCGGCT
CCAGCGACATCAGCGCCTTCTGGTTGCTGCATACCGTCAATCGCAACTTTGCTCGTTTGCGCCACCTGTC
GCTGAGCAACCCGCTGCACCCGGAAGAGCTGTACATGGCGCTGGCAGAGTTTTGTGGCGAGCTGCAGACG
TTTTCCACCCGCTATGCGCTGGTCGACATACCTGCCTACCGCCATGACGCTCTGCATGCGGTGTTTGCTG
CTTTGGACCTGCAGATACGGGAGTTGCTGGAAACCGTCATCTCGGCACGCTATGTCGTCATCCCGCTGCA
TTCCCCGAAGCCGTCCTTCCATATTGGCCGGCTGGAGAGCGACCGCCTGCTGGACAACGTCGACTTTTAC
CTTTCGGTGCAGAGCGAACAGCCGGCCAGCCAGGTCATCGACAACGTGCCGCTCAAGTTCAAGATCGGCG
CACCGGATGATGTCGAGAAGATTCTTAACTCCGCGATGCGCGGGGTGGCGCTGAGTCACGCGGCGCAAAC
GCCTTCCGCCGTGCCGGTGCGGGTGGGAAATCATTACTTTTCGCTCCAGCCGCACGGCGACATTTTTGCC
CGCATGTTGCAGTCGCGCAGCATCTGCATCTACGTTCCGCAAACCTTGTCCGGGCTGGCCCTGGAACTGA
TCGCCGTTTTCCGTTGA
 Primer design