SecReT6
Protein ID: 347538940
SecReT6 ID459
T6SS typei4b
Gene symboldotU
Locus tagNH8B_1120
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1145385..1146089 [+]
Producttype IV/VI secretion system protein, DotU family
NoteTssL
UniProt IDG2J002
KEGG IDpse:NH8B_1120
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-55, Aligned region: 24..224
Protein Sequence: 234 a.a.     [Download]
>gi|347538940|ref|YP_004846364.1| dotU gene product [Pseudogulbenkiania sp. NH8B]
MSQAVVTTTANESTINVASTGPSLREMLEDGVYLLFLLKDGNAPGSSVEFNRRIDQFLLQYERNARNFGK
SVEAIGQAKYAFCALLDEIILSSDFSLRDEWERMPLQLRLFGEHLAGEGFFNRLEQLRLEPARHIEELEV
YYTCLLLGFQGRYLLEGEEKLGYLTHKLGQEIQQVRGGKAEFAPNWQLPQRFQAYVRHELPLWLYFALLA
LAGAAIWGTYHWLLGRQLSKLFGI
 
Nucleotide Sequence: 705 bp     [Download]
>gi|347537839|ref|NC_016002.1|:1145385-1146089 Pseudogulbenkiania sp. NH8B, complete genome
ATGAGTCAAGCCGTCGTAACCACAACAGCCAACGAGTCCACCATCAACGTGGCCAGTACCGGCCCCAGCC
TGCGCGAGATGCTGGAAGACGGCGTGTACCTGCTGTTTCTGCTGAAAGACGGCAACGCGCCGGGCAGCAG
CGTGGAGTTCAACCGCCGTATCGACCAGTTCCTGCTCCAGTACGAACGCAACGCCCGCAACTTCGGCAAG
TCGGTGGAGGCTATCGGCCAAGCCAAATACGCGTTCTGTGCCTTGTTGGATGAGATCATTCTGTCGTCCG
ATTTTTCGCTGCGCGATGAGTGGGAGCGCATGCCGCTGCAACTGCGTCTGTTTGGCGAGCATCTGGCCGG
GGAAGGTTTCTTCAACCGACTGGAGCAACTGCGGCTGGAGCCGGCACGACACATTGAGGAACTGGAGGTG
TACTACACCTGCCTGCTGCTGGGCTTCCAGGGACGTTATCTGCTGGAGGGCGAAGAAAAACTCGGCTACC
TCACCCACAAGCTGGGGCAGGAAATCCAGCAGGTACGGGGTGGCAAGGCCGAATTCGCACCCAATTGGCA
GCTTCCTCAACGTTTCCAGGCCTATGTCCGCCATGAATTGCCTCTGTGGTTGTACTTCGCGCTGCTGGCC
TTGGCTGGCGCCGCGATCTGGGGGACTTACCACTGGCTGCTCGGCCGTCAGTTGAGCAAATTGTTCGGAA
TCTGA
 Primer design