SecReT6
Protein ID: 347538941
SecReT6 ID459
T6SS typei4b
Gene symbolimpF
Locus tagNH8B_1121
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1146093..1146578 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDG2J003
KEGG IDpse:NH8B_1121
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-22, Aligned region: 39..143
Protein Sequence: 161 a.a.     [Download]
>gi|347538941|ref|YP_004846365.1| impF gene product [Pseudogulbenkiania sp. NH8B]
MNAPSLRHTQILPSVLDRLLDDQPDLSHGTEHLLFELPQFRRALARDLEALLNTRVMAQPELFEAHTLAG
DSMLQFGIPDLSGISLLNPDDRELLREQLRRAIEIHEPRLSRVRVNLDAPRERERHLRFRVDAVLKVHPH
RPPVSFDATLQLSSNVYKVQG
 
Nucleotide Sequence: 486 bp     [Download]
>gi|347537839|ref|NC_016002.1|:1146093-1146578 Pseudogulbenkiania sp. NH8B, complete genome
ATGAATGCCCCCTCACTGCGGCATACCCAGATACTGCCTTCGGTGTTGGATCGTCTGCTGGACGACCAGC
CCGATCTCAGCCATGGGACCGAGCACCTGCTGTTCGAGCTGCCTCAGTTCCGCCGTGCGCTGGCGCGCGA
TCTCGAAGCGCTGCTCAATACCCGCGTCATGGCGCAGCCTGAACTGTTCGAGGCTCATACCCTGGCGGGG
GACAGCATGCTGCAATTCGGCATTCCCGACCTGAGCGGCATCAGCCTGCTGAATCCCGACGACCGCGAAC
TGTTACGTGAGCAACTGCGTCGCGCCATTGAAATCCACGAACCGCGTTTGTCCCGCGTCAGGGTGAATCT
GGATGCGCCGAGGGAAAGGGAGCGGCACCTGCGTTTCCGTGTCGATGCGGTACTGAAAGTACACCCGCAC
CGTCCCCCCGTGAGCTTTGACGCCACGCTGCAACTGTCGTCCAACGTTTACAAGGTTCAGGGCTGA
 Primer design