SecReT6
Protein ID: 347538942
SecReT6 ID459
T6SS typei4b
Gene symbolvgrG
Locus tagNH8B_1122
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1146596..1149298 [+]
Producttype VI secretion system, Vgr family protein
NoteTssI
UniProt IDG2J004
KEGG IDpse:NH8B_1122
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-68, Aligned region: 44..375
DUF2345 [PF10106], Evalue: 8.70E-50, Aligned region: 712..868
T6SS_Vgr [PF13296], Evalue: 2.10E-36, Aligned region: 446..459
T6SS_Vgr [PF13296], Evalue: 2.10E-36, Aligned region: 553..661
T6SS_Vgr [PF13296], Evalue: 2.10E-36, Aligned region: 738..761
Phage_base_V [PF04717], Evalue: 1.30E-25, Aligned region: 436..536
Protein Sequence: 900 a.a.     [Download]
>gi|347538942|ref|YP_004846366.1| vgrG gene product [Pseudogulbenkiania sp. NH8B]
MDLSPLLASFAAAFSQEQRLLTLHLGDGPRWGETLLPLAVHGDEAVSDSYRYRVECLSPDAGLELKSLLG
VPVRLGLAGADGTEQVRGGVVSAVDSLGADGGFAKYALTVEPPFALLRLRRTSRVFQDLSVPDIVRQVFA
EHAAANPVFAAVQRLDFVLAGELPSRSYCLQYRESDYDFLVRLLHEEGLAWRFEHGERASEPGRAASRGA
LPQVQLVAFDDPYSPPAAGVERVRFHRSDATEEEDGLTRWDGTRQIVSGGVTLASFDYQPVATGHSGDSS
AVEQGSDGTRLQSSLQDYDVPGPYYAGDADQLAHYARLRQQAHDAQAKRFDGGGSVRGLAAGQWFRLDDH
PAHEGDAPEQREFVVTRQAFTARNNLPTDLARALPPSLRPTSTAGAGADTSASDVPYHTTFSAQRRGLPL
TPAYAGTALAKPTARGAQTATVVGPAGEEIHTDAHGRIKVQFHWQRPDEHPTIGANLDDTSSCWLRVAMP
AAGAGWGHQFIPRIGQEVLVDFLEGDIDRPIITGVLYNGSHPPPAFSGTGNLPANKTLSGIKSKEHQGGQ
YNELLFDDTPGEVRAKLSSEHGATQLNQGYLVHPRADGKATPRGDGFELRTDRHGAIRAGHGLLLSTEAQ
PSVSGKQLARDGAQSQLDAALSLSQSLGETATAQLADTVEIGPETIQPDNGKGAKKPDGHLQHHVQALKA
WEAGTNTNKDGKNSPNGAGQAGQQPLMVLSAPAGLAATTDNSLTLAAGTNIDQIAQRDTQQTSGRRWLHN
VGQHISLFVAGVKDAVSLKLIAAKGKVQVQAQSDAMELTADRDVTISSLNASQLFNGKKEVLLTSGGAYI
RIKDGKIELHAPGKVSFKGGSHDWSGPAKMNVAHQLFPKSICIDCLLRSAKAGSAFSKVQ
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|347537839|ref|NC_016002.1|:1146596-1149298 Pseudogulbenkiania sp. NH8B, complete genome
ATGGATCTTTCCCCCTTGCTTGCCAGCTTCGCCGCCGCCTTCAGCCAGGAGCAGCGCCTCCTCACCCTGC
ACCTGGGCGACGGCCCGCGCTGGGGCGAGACGCTGCTGCCACTCGCCGTGCACGGCGACGAGGCGGTCTC
CGACAGCTACCGCTACCGCGTCGAGTGCCTGTCGCCCGACGCCGGGCTCGAACTGAAGTCGCTGCTCGGC
GTGCCGGTGCGGCTCGGCCTCGCCGGGGCGGACGGGACCGAGCAGGTGCGCGGCGGTGTGGTCAGCGCTG
TCGACAGCCTGGGGGCCGACGGCGGCTTTGCCAAGTACGCCCTTACCGTCGAACCGCCGTTCGCGCTGCT
GCGCCTGCGCCGTACCTCGCGGGTGTTCCAGGACCTCTCGGTGCCCGACATTGTGCGCCAGGTGTTCGCC
GAACACGCCGCCGCCAACCCGGTGTTCGCGGCGGTGCAGCGTCTCGACTTCGTGCTCGCGGGCGAGCTGC
CCTCCCGCAGTTACTGCCTGCAATACCGCGAGAGCGACTACGACTTCCTCGTGCGCCTGCTGCACGAGGA
AGGGTTGGCCTGGCGCTTTGAGCATGGAGAGAGAGCGAGCGAGCCAGGTCGCGCCGCGTCGCGAGGGGCT
CTCCCGCAGGTCCAGCTCGTCGCCTTCGACGACCCGTATTCGCCGCCGGCCGCCGGGGTGGAGCGGGTGC
GCTTCCACCGCAGCGATGCGACGGAAGAAGAGGATGGCCTCACGCGCTGGGACGGCACGCGCCAGATCGT
TAGCGGCGGCGTGACGCTGGCCAGCTTCGACTACCAGCCTGTCGCCACCGGCCACAGCGGCGATAGCAGC
GCCGTCGAGCAGGGCTCCGATGGGACGCGGTTGCAAAGCAGCCTGCAGGACTACGACGTCCCCGGCCCCT
ACTACGCCGGCGACGCCGACCAGCTCGCCCACTACGCCCGGCTGCGCCAGCAGGCGCACGACGCGCAGGC
CAAGCGCTTCGACGGTGGCGGCTCGGTGCGCGGGCTCGCCGCCGGGCAGTGGTTCCGCCTCGACGATCAC
CCGGCGCACGAGGGGGACGCTCCCGAACAGCGCGAATTCGTCGTCACGCGCCAGGCCTTCACCGCCCGCA
ACAACCTACCGACCGACCTGGCACGGGCGCTGCCGCCCAGCCTTCGGCCAACCTCGACCGCCGGCGCGGG
GGCCGACACCTCGGCAAGCGACGTTCCGTACCACACCACCTTCAGCGCCCAGCGCCGCGGCCTGCCGCTC
ACCCCGGCCTACGCCGGCACCGCGCTGGCCAAGCCCACCGCGCGCGGCGCCCAGACCGCCACCGTGGTCG
GGCCTGCGGGGGAAGAGATCCACACCGACGCCCACGGCCGCATCAAGGTCCAGTTCCACTGGCAGCGTCC
CGACGAACACCCGACGATCGGCGCCAACCTCGACGACACCTCCAGCTGCTGGCTGCGCGTCGCCATGCCC
GCGGCCGGCGCCGGCTGGGGCCACCAGTTCATCCCGCGTATCGGCCAGGAAGTGCTGGTCGACTTCCTCG
AAGGCGACATCGACCGCCCGATCATCACCGGCGTGCTGTACAACGGCAGCCACCCGCCGCCCGCCTTCAG
CGGCACCGGCAACCTGCCGGCCAACAAGACCCTGTCCGGCATCAAGTCGAAAGAGCACCAGGGCGGCCAG
TACAACGAACTCTTGTTCGACGACACCCCCGGCGAAGTGCGCGCCAAACTGTCGTCCGAACACGGCGCCA
CCCAGCTCAACCAGGGCTACCTCGTCCACCCGCGTGCCGACGGCAAGGCCACGCCCCGCGGCGACGGCTT
CGAACTGCGCACCGACCGCCATGGCGCGATCCGCGCCGGCCACGGCCTGCTGCTCAGCACCGAAGCGCAG
CCCTCCGTCTCCGGCAAACAACTGGCGCGCGACGGCGCGCAAAGCCAGCTTGATGCGGCCCTGAGCCTGA
GCCAGTCCCTCGGCGAGACCGCTACCGCACAGCTGGCCGATACCGTTGAAATCGGGCCGGAGACGATTCA
GCCGGACAACGGCAAGGGAGCGAAGAAGCCCGACGGACACCTGCAGCACCACGTCCAAGCGCTGAAGGCC
TGGGAAGCCGGAACCAATACCAATAAAGATGGCAAAAACTCCCCCAACGGCGCGGGACAGGCAGGCCAAC
AACCGCTGATGGTCCTGTCCGCCCCGGCCGGCCTCGCCGCAACCACCGACAACAGCCTCACCCTGGCGGC
TGGGACGAATATCGACCAAATCGCCCAGCGCGATACCCAACAGACCTCGGGCCGGCGCTGGCTGCACAAC
GTGGGGCAGCACATCAGCCTGTTCGTCGCCGGAGTGAAGGACGCGGTGAGTCTGAAACTGATCGCCGCCA
AGGGCAAGGTGCAGGTCCAGGCGCAAAGCGATGCGATGGAGCTGACGGCAGATAGGGATGTGACCATCAG
CAGCCTGAACGCCAGCCAGCTGTTCAACGGCAAGAAAGAAGTGCTGCTGACCAGCGGCGGTGCCTACATC
CGCATCAAGGACGGCAAGATCGAACTGCACGCGCCGGGCAAGGTGAGCTTCAAGGGCGGCAGCCACGACT
GGAGCGGGCCGGCAAAAATGAACGTGGCGCATCAGCTATTTCCCAAATCAATATGCATTGATTGCTTATT
GCGTAGCGCCAAGGCCGGTTCGGCATTCAGCAAGGTGCAATGA
 Primer design