SecReT6
Protein ID: 347538949
SecReT6 ID459
T6SS typei4b
Gene symbolimpG
Locus tagNH8B_1129
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1154392..1156248 [+]
Producttype VI secretion protein ImpG
NoteTssF
UniProt IDG2J011
KEGG IDpse:NH8B_1129
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-203, Aligned region: 5..617
Protein Sequence: 618 a.a.     [Download]
>gi|347538949|ref|YP_004846373.1| impG gene product [Pseudogulbenkiania sp. NH8B]
MLESLLPYYERELGHLRELSGEFARRYPKIAGRLQLEGDQCEDPHTERLIEAFAFLAARVHKKLDDDYPE
VATSFLDVMYPHYLQPMPAATVVQFECDTQRPEIGKRYRIERGQQVLAPAIQGVNCKFRSVYPVDLYPLQ
LQEARLELTSGSPYLRSLAPDAAAVLTLKLQTQGGVLLNAIDLQSLRFFLDGEPALMHLLYELLLSSVLR
VQVGDGSEDPARTRMLAADSLQAVGFGADEGMLEYDERSFLGYRLLSEYFSYPDKFLFIDLLNLAPLVAR
LQGDTLLLRIQLRDYPDSERHHRLQSQLQPAHLKLGCAPLINLFTQPGEPIRVTHQKSSYPVLADARKQQ
AYEVVQIRRVVRVEKSGEGDSSEEVPPFYATRHGSGQAPRFYWHATREPSVRQGDRGTDMALHLVDLQFD
AVRPAGEVLSLDLLCSNRDLPEQIPFGGSQATQRTDFQLPGHSVVKRVRLLRKPGASQRSPLGRAVQWRL
ISHLSLNYMSIVDSGREALQEMLTLYNLGDAAANVRQIQGIVGIRSEPAVQRVNGRHFSGFVRGTEITLT
LDADYYVGGSVYLFASLLERFFALYCAPNSFTRLRVRTVQRDEEVAAWPARAGEALVI
 
Nucleotide Sequence: 1857 bp     [Download]
>gi|347537839|ref|NC_016002.1|:1154392-1156248 Pseudogulbenkiania sp. NH8B, complete genome
ATGCTCGAATCCCTCCTTCCCTATTACGAACGCGAGCTCGGCCATCTGCGCGAGCTGTCGGGTGAGTTCG
CCCGCCGTTACCCCAAGATTGCCGGCCGCTTGCAGCTGGAAGGCGACCAGTGCGAAGACCCGCATACCGA
GCGGCTGATCGAGGCGTTTGCCTTTCTGGCGGCGCGGGTGCACAAGAAGCTGGATGACGACTACCCGGAG
GTGGCCACCAGCTTTCTGGATGTGATGTACCCGCACTATCTGCAGCCGATGCCGGCGGCCACCGTGGTGC
AGTTCGAATGCGATACGCAGCGGCCGGAGATCGGCAAGCGCTACCGTATCGAGCGCGGGCAGCAGGTGCT
GGCGCCGGCCATCCAGGGGGTGAACTGCAAGTTTCGCAGCGTCTACCCGGTGGACTTGTACCCGCTGCAG
CTGCAGGAGGCCCGGCTGGAGCTGACCAGCGGCTCTCCCTACCTGCGCAGCCTGGCGCCGGATGCGGCGG
CGGTGCTGACGCTGAAGCTGCAGACCCAGGGCGGGGTGTTGCTGAATGCCATCGATTTGCAGTCGCTGCG
CTTTTTCCTGGACGGTGAGCCGGCGCTAATGCACCTGCTGTACGAGCTGTTGCTATCCAGCGTGCTGCGG
GTGCAGGTGGGGGATGGCAGCGAAGACCCGGCACGTACGCGCATGTTGGCCGCAGACAGCCTGCAGGCGG
TCGGCTTTGGTGCGGATGAAGGCATGCTGGAGTACGACGAGCGCTCCTTCCTGGGCTACCGTTTGCTGTC
GGAATACTTCAGCTACCCGGACAAATTCCTGTTCATCGACCTGCTGAACCTGGCGCCGCTGGTGGCCCGG
CTGCAGGGCGACACGCTGCTGCTGCGCATCCAGCTGCGCGACTACCCGGACAGTGAGCGCCACCACCGGC
TGCAAAGCCAGCTGCAGCCGGCGCACCTCAAGCTGGGCTGCGCGCCGCTGATCAACCTGTTTACCCAGCC
GGGCGAGCCAATCCGCGTGACGCACCAGAAAAGCAGCTACCCGGTGCTGGCCGACGCGCGCAAGCAGCAG
GCCTACGAGGTGGTGCAGATCCGCCGCGTGGTGCGGGTGGAAAAATCCGGCGAGGGCGACAGCAGCGAGG
AAGTGCCACCGTTCTACGCCACCCGGCACGGCAGCGGCCAGGCGCCGCGCTTCTACTGGCATGCCACCCG
CGAGCCATCGGTGCGCCAGGGCGACCGTGGCACCGACATGGCGTTGCACCTGGTGGATTTGCAGTTCGAC
GCGGTACGCCCGGCCGGCGAGGTGCTGAGTCTGGACTTGCTGTGCAGCAACCGCGATCTGCCGGAGCAGA
TTCCCTTCGGCGGCAGCCAGGCCACCCAGCGCACGGATTTCCAGTTGCCGGGGCATTCGGTGGTGAAGCG
GGTGCGCTTGTTGCGCAAGCCCGGCGCCAGCCAGCGCAGTCCGCTGGGGCGGGCGGTGCAGTGGCGCCTG
ATCTCGCACCTGTCGCTCAATTACATGTCTATCGTCGATTCCGGACGCGAGGCGCTGCAGGAAATGCTGA
CGCTGTACAACCTGGGCGATGCGGCGGCCAATGTACGGCAGATCCAGGGCATTGTCGGCATCCGCAGCGA
ACCGGCGGTACAGCGCGTCAACGGCCGGCATTTCTCCGGTTTCGTGCGCGGTACCGAGATCACCCTGACG
CTGGATGCCGATTACTACGTCGGCGGCAGCGTCTACCTGTTCGCCTCCCTGCTGGAGCGGTTCTTCGCGC
TGTACTGCGCCCCCAACAGTTTTACCCGTCTGCGTGTCAGGACGGTGCAACGTGACGAGGAGGTGGCGGC
ATGGCCAGCCCGAGCCGGCGAAGCCCTCGTGATCTGA
 Primer design