SecReT6
Protein ID: 347538950
SecReT6 ID459
T6SS typei4b
Gene symbolimpH
Locus tagNH8B_1130
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1156212..1157228 [+]
Producttype VI secretion protein ImpH
NoteTssG
UniProt IDG2J012
KEGG IDpse:NH8B_1130
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-88, Aligned region: 18..323
Protein Sequence: 338 a.a.     [Download]
>gi|347538950|ref|YP_004846374.1| impH gene product [Pseudogulbenkiania sp. NH8B]
MASPSRRSPRDLKLALARDASQFGFFQAVRLLGLCEGARRQRRTLPAQLRFRTLASLSFPASELVQYQPA
AEEGTAPAEMTVSFMGLTGPSGVLPTAYTELLLERRQQYRDTTLHSFLDLFSHRAIALFYAAWRKYRFWL
AEEAGEQDGFSRNLLDLAGVGLSRLRGQAAQDGLLNERLFIYYAGLLSQKPLSALTLQTLVEGLFGARAQ
LQQFAGLWLEVPLAEQSQLGGQSCELGVSLFAGERQWDRQTKLQLRLGCLRRAQFEALLPGGDGARALQA
LMQFAVGHQLAVDVCLVLDKHDVPPARLDADAPLRLGASSWLGARAADPDDVRYALLH
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|347537839|ref|NC_016002.1|:1156212-1157228 Pseudogulbenkiania sp. NH8B, complete genome
ATGGCCAGCCCGAGCCGGCGAAGCCCTCGTGATCTGAAGCTGGCGCTGGCCAGGGATGCCAGCCAGTTCG
GCTTTTTCCAGGCGGTGCGCCTCCTAGGCTTGTGTGAGGGCGCGCGTCGCCAGCGGCGCACGCTGCCGGC
TCAACTGCGCTTCCGCACCCTGGCGTCGCTGTCGTTTCCAGCCAGCGAGCTGGTGCAGTACCAGCCAGCG
GCGGAGGAGGGCACGGCGCCCGCCGAGATGACGGTCAGCTTCATGGGGCTGACCGGGCCCAGCGGGGTGT
TGCCGACGGCGTATACCGAGCTCTTGCTAGAGCGGCGGCAGCAATACCGCGACACCACTCTTCATTCCTT
TCTCGATCTGTTCAGCCACCGCGCCATCGCCTTGTTCTACGCGGCCTGGCGCAAGTACCGCTTCTGGCTG
GCCGAGGAGGCCGGCGAGCAGGATGGCTTCAGCCGCAACCTGCTGGATCTGGCCGGGGTCGGTTTGAGCC
GGTTGCGTGGGCAGGCGGCGCAGGACGGCCTGCTGAATGAGCGGCTGTTCATTTATTACGCAGGCCTGTT
GAGCCAGAAGCCGCTGTCGGCCCTGACGCTGCAGACCTTGGTGGAGGGGCTGTTCGGCGCCCGTGCCCAG
TTGCAGCAGTTCGCGGGGCTGTGGCTGGAGGTGCCGTTGGCTGAGCAAAGCCAGCTGGGTGGCCAGTCCT
GCGAACTGGGGGTGTCGCTGTTCGCCGGCGAGCGGCAGTGGGATCGCCAGACCAAGCTGCAACTGCGCCT
GGGGTGTTTGCGTCGTGCGCAATTCGAGGCCTTGCTGCCGGGGGGAGATGGAGCTCGCGCCTTGCAAGCG
CTGATGCAGTTTGCCGTGGGGCACCAACTGGCGGTGGATGTCTGCCTGGTGCTCGACAAGCACGATGTGC
CGCCGGCACGGCTGGATGCAGATGCCCCATTGCGGCTGGGGGCCAGCAGTTGGCTGGGGGCGCGGGCAGC
CGACCCGGACGACGTGCGCTATGCGCTGTTGCACTGA
 Primer design