SecReT6
Protein ID: 347538951
SecReT6 ID459
T6SS typei4b
Gene symbolclpV
Locus tagNH8B_1131
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1157291..1159918 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDG2J0H2
KEGG IDpse:NH8B_1131
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.70E-42, Aligned region: 226..246
AAA_2 [PF07724], Evalue: 3.70E-42, Aligned region: 601..774
AAA [PF00004], Evalue: 1.40E-20, Aligned region: 227..339
AAA [PF00004], Evalue: 1.40E-20, Aligned region: 485..503
AAA [PF00004], Evalue: 1.40E-20, Aligned region: 607..691
AAA [PF00004], Evalue: 1.40E-20, Aligned region: 784..844
AAA_5 [PF07728], Evalue: 1.30E-16, Aligned region: 227..252
AAA_5 [PF07728], Evalue: 1.30E-16, Aligned region: 606..724
ClpB_D2-small [PF10431], Evalue: 1.90E-11, Aligned region: 781..854
Clp_N [PF02861], Evalue: 2.10E-10, Aligned region: 23..71
Clp_N [PF02861], Evalue: 2.10E-10, Aligned region: 105..125
AAA_22 [PF13401], Evalue: 6.10E-10, Aligned region: 226..321
AAA_22 [PF13401], Evalue: 6.10E-10, Aligned region: 603..629
AAA_22 [PF13401], Evalue: 6.10E-10, Aligned region: 668..700
AAA_16 [PF13191], Evalue: 8.70E-10, Aligned region: 37..75
AAA_16 [PF13191], Evalue: 8.70E-10, Aligned region: 204..260
AAA_16 [PF13191], Evalue: 8.70E-10, Aligned region: 271..306
AAA_16 [PF13191], Evalue: 8.70E-10, Aligned region: 490..510
AAA_16 [PF13191], Evalue: 8.70E-10, Aligned region: 507..532
AAA_16 [PF13191], Evalue: 8.70E-10, Aligned region: 576..644
AAA_16 [PF13191], Evalue: 8.70E-10, Aligned region: 671..695
AAA_19 [PF13245], Evalue: 1.40E-07, Aligned region: 227..248
AAA_19 [PF13245], Evalue: 1.40E-07, Aligned region: 602..628
AAA_17 [PF13207], Evalue: 2.50E-07, Aligned region: 227..268
AAA_17 [PF13207], Evalue: 2.50E-07, Aligned region: 605..644
IstB_IS21 [PF01695], Evalue: 3.70E-06, Aligned region: 215..249
IstB_IS21 [PF01695], Evalue: 3.70E-06, Aligned region: 606..626
Zeta_toxin [PF06414], Evalue: 4.10E-06, Aligned region: 227..247
Zeta_toxin [PF06414], Evalue: 4.10E-06, Aligned region: 308..376
Zeta_toxin [PF06414], Evalue: 4.10E-06, Aligned region: 601..646
AAA_18 [PF13238], Evalue: 5.50E-06, Aligned region: 227..250
AAA_18 [PF13238], Evalue: 5.50E-06, Aligned region: 607..635
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 227..251
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 426..482
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 602..631
Sigma54_activat [PF00158], Evalue: 1.10E-05, Aligned region: 221..244
Sigma54_activat [PF00158], Evalue: 1.10E-05, Aligned region: 604..706
AAA_14 [PF13173], Evalue: 5.40E-05, Aligned region: 227..341
AAA_14 [PF13173], Evalue: 5.40E-05, Aligned region: 604..687
AAA_29 [PF13555], Evalue: 0.00011, Aligned region: 219..243
AAA_29 [PF13555], Evalue: 0.00011, Aligned region: 602..631
NACHT [PF05729], Evalue: 0.00034, Aligned region: 227..254
NACHT [PF05729], Evalue: 0.00034, Aligned region: 606..631
TIP49 [PF06068], Evalue: 0.00065, Aligned region: 227..248
TIP49 [PF06068], Evalue: 0.00065, Aligned region: 275..307
TIP49 [PF06068], Evalue: 0.00065, Aligned region: 574..641
RNA_helicase [PF00910], Evalue: 0.0012, Aligned region: 228..248
RNA_helicase [PF00910], Evalue: 0.0012, Aligned region: 607..628
NTPase_1 [PF03266], Evalue: 0.0013, Aligned region: 227..249
NTPase_1 [PF03266], Evalue: 0.0013, Aligned region: 606..628
Arch_ATPase [PF01637], Evalue: 0.0014, Aligned region: 206..242
Arch_ATPase [PF01637], Evalue: 0.0014, Aligned region: 280..323
Arch_ATPase [PF01637], Evalue: 0.0014, Aligned region: 602..645
Arch_ATPase [PF01637], Evalue: 0.0014, Aligned region: 673..701
MobB [PF03205], Evalue: 0.0029, Aligned region: 228..255
MobB [PF03205], Evalue: 0.0029, Aligned region: 605..637
AAA_30 [PF13604], Evalue: 0.0035, Aligned region: 218..245
AAA_30 [PF13604], Evalue: 0.0035, Aligned region: 447..482
AAA_30 [PF13604], Evalue: 0.0035, Aligned region: 602..635
AAA_28 [PF13521], Evalue: 0.0041, Aligned region: 227..246
AAA_28 [PF13521], Evalue: 0.0041, Aligned region: 606..626
SRP54 [PF00448], Evalue: 0.0058, Aligned region: 21..50
SRP54 [PF00448], Evalue: 0.0058, Aligned region: 227..255
SRP54 [PF00448], Evalue: 0.0058, Aligned region: 605..629
ResIII [PF04851], Evalue: 0.0066, Aligned region: 217..241
ResIII [PF04851], Evalue: 0.0066, Aligned region: 297..309
ResIII [PF04851], Evalue: 0.0066, Aligned region: 578..628
AAA_33 [PF13671], Evalue: 0.0084, Aligned region: 228..246
AAA_33 [PF13671], Evalue: 0.0084, Aligned region: 605..627
AAA_33 [PF13671], Evalue: 0.0084, Aligned region: 791..854
Protein Sequence: 875 a.a.     [Download]
>gi|347538951|ref|YP_004846375.1| clpV gene product [Pseudogulbenkiania sp. NH8B]
MSVSLKSLIERLTPLARQSVEQAASRALSRTHYEIEIEHVLLTLLDQDMNAARAALPAAGIDLADLQHGL
EGALDGFRTGNTRNPVLSAWLPKWLEKAWLLASAEFGQESVSTLDLLLALLRDESLRPAVQSGCPALLRV
EAGRLQPAYAALRQHGGEGGGPVAATEHDQPAEMPAGRVRSGVALDKYTIDLTAQARAGKIDPVLGRDGE
IRQMIDILMRRRQNNPILTGEPGVGKTAVVEGLARKIVHGEVPPVLAGVCLRTLDLGLLQAGASVKGEFE
YRLRQVIDEVKASPVSIILFIDEAHTLIGAGGAAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKD
AALARRFQVVKVEEPAPEVAVQMVRGLTHAMATHHQVEILNEAVAAAVHLSSRYITGRQLPDKAISVLDT
ACARVALSRAGKPGPIEDVAVLIANAEREIAALQREEGHAERIAELEARRGELQADLERLHTAWEAQQQL
VAEIDELKQQQGEVKPAKGKKVSPLQAKRQALRELHKQQPLAFECVDESVIADVIAGWTGIPLGRMVSNE
LAQVQQLARLLGERVIGQDHALEQIAERVQIAKAGLEDPGKPKGVFLLVGPSGVGKTETALALAEALYGG
ERNLITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFD
KGVLEDSEGREVDFKNTIILLTSNAGSELVMRACEHGVTVEGETREPTPDDLVEILRPTLQQVFKPAFLG
RLAIVPYFPIGDEVLHAIVGLKLDKIRQRIADNHGAKVEFPDELAGIMAARCLDVDSGARNADAILTRTL
LAQISSDLLARMASGKPVKKIAVALKGEQLKVRVS
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|347537839|ref|NC_016002.1|:1157291-1159918 Pseudogulbenkiania sp. NH8B, complete genome
ATGTCGGTATCCCTGAAATCCCTGATCGAGCGCCTGACGCCGCTGGCGCGGCAGAGTGTGGAGCAGGCCG
CCAGCCGCGCCTTGTCCCGTACCCACTACGAGATCGAGATTGAGCATGTGCTGTTGACCCTGCTCGACCA
AGACATGAATGCCGCCCGCGCCGCCTTACCGGCAGCCGGCATCGATCTGGCCGATTTGCAACATGGGCTG
GAGGGTGCTCTGGATGGCTTCCGTACTGGTAATACCCGCAACCCGGTGCTGTCGGCCTGGTTGCCCAAGT
GGCTGGAGAAAGCCTGGCTGCTGGCCAGCGCGGAGTTCGGTCAGGAGAGTGTGTCCACGCTGGATTTGCT
GTTGGCGCTGTTGCGTGATGAATCGCTGCGTCCGGCGGTGCAAAGCGGCTGCCCGGCCCTGCTGCGCGTC
GAAGCGGGTCGCTTGCAACCGGCTTACGCCGCGTTGCGCCAGCATGGCGGGGAGGGCGGCGGGCCGGTGG
CGGCCACCGAGCACGATCAGCCGGCGGAGATGCCGGCCGGTAGGGTCCGCAGCGGCGTGGCACTCGACAA
ATACACCATCGACCTGACCGCCCAGGCGCGTGCCGGCAAGATCGATCCGGTGCTGGGGCGCGATGGCGAG
ATCCGCCAGATGATCGACATCCTGATGCGCCGCCGACAGAACAACCCCATCCTGACCGGCGAGCCCGGCG
TGGGCAAGACCGCGGTGGTGGAAGGGCTGGCGCGCAAGATCGTGCACGGCGAGGTGCCGCCGGTATTGGC
CGGTGTCTGTCTGCGCACACTGGACCTGGGGCTGTTGCAGGCCGGTGCCAGTGTGAAGGGGGAGTTCGAA
TACCGTCTGCGTCAGGTGATCGACGAGGTGAAGGCGAGCCCGGTGTCCATCATCCTGTTCATCGACGAGG
CGCACACGCTGATCGGCGCCGGCGGCGCGGCCGGTCAGAACGACGCGGCCAACCTGCTCAAGCCGGCGCT
GGCGCGTGGCGAGCTGCGCACCATCGCGGCCACCACCTGGGCCGAGTACAAGAAGTATTTCGAGAAGGAC
GCCGCCTTGGCGCGCCGCTTCCAGGTGGTGAAGGTGGAGGAGCCGGCGCCGGAGGTGGCGGTGCAGATGG
TGCGCGGGCTGACGCACGCCATGGCCACCCATCATCAGGTGGAAATCCTCAACGAGGCGGTCGCCGCCGC
CGTGCATCTGTCGAGTCGCTACATCACCGGCCGCCAGTTGCCGGACAAGGCCATCAGCGTGCTGGATACC
GCCTGCGCCCGCGTGGCGCTGTCGCGCGCCGGCAAGCCGGGACCGATCGAGGACGTGGCGGTGCTGATCG
CCAATGCCGAGCGCGAGATTGCCGCCTTGCAGCGCGAGGAGGGCCATGCCGAGCGTATCGCCGAGCTGGA
AGCCCGGCGCGGCGAGTTGCAGGCCGACCTGGAGCGCCTGCACACGGCCTGGGAGGCGCAGCAGCAACTG
GTGGCCGAGATTGACGAGCTGAAACAGCAGCAGGGGGAGGTTAAGCCAGCCAAGGGCAAGAAGGTCAGCC
CGCTGCAGGCCAAGCGCCAGGCTTTGCGTGAGCTGCACAAGCAGCAGCCGCTGGCGTTCGAGTGCGTCGA
CGAGAGTGTGATCGCCGACGTGATCGCCGGCTGGACCGGTATCCCGCTGGGGCGCATGGTCAGCAACGAG
CTGGCTCAGGTACAGCAGCTGGCGCGGCTGTTGGGGGAACGGGTGATCGGCCAGGATCACGCGCTCGAGC
AGATCGCCGAGCGGGTGCAGATTGCCAAGGCCGGCCTGGAAGACCCGGGCAAGCCCAAGGGGGTGTTCCT
GCTGGTGGGGCCATCCGGCGTCGGCAAGACCGAGACCGCGCTGGCGCTGGCCGAGGCCTTGTACGGCGGC
GAGCGCAATCTCATCACCATCAATATGTCGGAATACCAGGAGGCGCACAGCGTGTCCGGGCTCAAGGGCT
CACCGCCGGGCTATGTCGGCTATGGAGAGGGTGGAGTGCTGACCGAGGCGGTACGCCGCAAGCCGTATTC
GGTGGTGTTGCTGGACGAGGTGGAGAAGGCGCATCCGGACGTGCTGGAGCTGTTTTTCCAGGTGTTCGAC
AAGGGGGTGCTGGAGGACAGCGAAGGGCGCGAGGTGGATTTCAAGAACACCATCATCCTGTTGACGTCGA
ACGCCGGCTCCGAGTTGGTGATGCGTGCCTGCGAGCACGGTGTGACGGTGGAAGGCGAGACGCGCGAGCC
GACGCCGGATGACCTGGTGGAAATTCTACGGCCCACCCTGCAGCAGGTGTTCAAACCGGCCTTCTTGGGA
CGCTTGGCCATCGTGCCGTACTTCCCGATCGGCGACGAGGTGTTGCACGCCATCGTGGGTCTGAAGCTGG
ACAAAATCCGCCAGCGCATCGCGGACAACCACGGTGCCAAGGTGGAGTTTCCGGATGAGCTGGCAGGCAT
CATGGCGGCGCGTTGCCTGGACGTGGACAGCGGTGCGCGCAACGCCGACGCCATCCTCACACGCACGTTG
CTGGCACAGATTTCGAGCGACCTGCTCGCCCGCATGGCCAGCGGCAAACCGGTGAAGAAGATTGCTGTGG
CGCTCAAGGGCGAGCAGCTCAAGGTTCGCGTCAGCTAG
 Primer design