SecReT6
Protein ID: 347538954
SecReT6 ID459
T6SS typei4b
Gene symbolimpA
Locus tagNH8B_1134
StrainPseudogulbenkiania sp. NH8B
Repliconchromosome [GenBank: NC_016002] [Browse all T6SS(s) in this replicon]
Location [Strand]1161657..1162754 [+]
ProductImpA-like N-terminal family protein
NoteTssA
UniProt IDG2J0H5
KEGG IDpse:NH8B_1134
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.90E-22, Aligned region: 57..115
Protein Sequence: 365 a.a.     [Download]
>gi|347538954|ref|YP_004846378.1| impA gene product [Pseudogulbenkiania sp. NH8B]
MQNPSVALLLAPLPGGHPAGEDLAYSPLFDQIREARRSDDPLLSQGDWEQALKVAEWPKVIRLCEEALSL
RSKDLQLLVWYAEAQVQVHGLASLAQGLAALADWLEHYWESGYPEFDPHDLDERVGKLEWLNLQLGVAIR
SSPLVKPEHGGYSWQQWRQSREVDNLALKDPEAKLAALAEGKLAGEDFDKGAALSGHAWFASQAELLLAS
LSAYEALDKRLDERFGDEAPSLAEVRNAIYACQELVLRYRQQLGGAAVVATPSAPPSHTALPENTAMPSA
IPTTPAVTAPAPTFDGQVSSRQQAVQMLAEVARYFRHNEPHSPVALLAERAARWAEMSLEEWLQHVVKDD
STLRQLQELLDINHS
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|347537839|ref|NC_016002.1|:1161657-1162754 Pseudogulbenkiania sp. NH8B, complete genome
ATGCAGAACCCTTCTGTTGCGCTTTTGCTGGCCCCCTTGCCGGGCGGTCATCCCGCCGGGGAAGACCTGG
CTTATTCCCCCTTGTTCGACCAGATCCGCGAGGCCCGGCGCAGCGATGATCCGTTGCTGTCCCAAGGCGA
CTGGGAGCAGGCTTTGAAAGTGGCCGAATGGCCCAAGGTGATCCGCCTGTGCGAGGAGGCCCTGAGCCTG
CGCAGCAAGGATTTGCAGCTGCTGGTTTGGTATGCCGAAGCCCAAGTGCAGGTACATGGCCTGGCCAGCC
TGGCGCAGGGGCTGGCCGCCTTGGCCGACTGGCTGGAGCATTACTGGGAGAGCGGCTACCCGGAGTTCGA
CCCGCATGATCTGGATGAGCGGGTAGGCAAGCTGGAGTGGCTCAACCTGCAACTCGGCGTGGCTATCCGC
AGTAGCCCACTCGTCAAGCCCGAGCATGGCGGTTACAGCTGGCAGCAGTGGAGGCAGTCCCGCGAGGTGG
ATAATCTGGCCCTGAAAGATCCGGAGGCGAAACTGGCGGCGTTGGCCGAGGGAAAGCTTGCCGGCGAGGA
CTTCGATAAGGGGGCTGCCTTGTCGGGTCATGCCTGGTTCGCCAGCCAGGCCGAGCTGCTGTTGGCGTCG
CTGAGTGCCTACGAGGCATTGGACAAGCGACTCGATGAGCGTTTCGGCGATGAAGCGCCGAGCCTTGCCG
AGGTGCGCAACGCCATTTACGCCTGCCAGGAGCTGGTGCTGCGTTACCGCCAGCAACTGGGCGGCGCTGC
GGTGGTCGCTACACCCAGCGCGCCACCTTCCCATACCGCGCTGCCGGAGAACACCGCCATGCCTTCTGCC
ATTCCGACAACTCCAGCAGTGACGGCACCGGCGCCCACTTTCGACGGCCAAGTCAGTAGCCGCCAGCAGG
CGGTACAGATGTTGGCCGAGGTCGCCCGTTACTTTCGTCACAACGAACCGCACAGCCCGGTGGCGTTGCT
GGCCGAGCGTGCTGCACGCTGGGCGGAAATGAGCCTGGAAGAATGGCTGCAGCATGTGGTGAAGGATGAC
TCGACACTGCGCCAGTTGCAGGAGCTGCTGGATATCAACCACAGCTGA
 Primer design