SecReT6
Protein ID: 348589433
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0081
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]80496..81725 [-]
Productprotein ImpH/VasB
NoteTssG
UniProt IDG4QD55
KEGG IDtas:TASI_0081
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.30E-100, Aligned region: 20..317
Protein Sequence: 409 a.a.     [Download]
>gi|348589433|ref|YP_004873895.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MNKRVSKLPPDYWLNLAEYPYDHSFYQVMRYLDAKLQLRKPIGRNISPTHEPFRMRQEPSMIFAPSNLTR
VDIHDNGRPPTISILGFGLWGPNGPLPLHLTEYAKERIYHHRDKTLSAFSDIFHHRLITLFYRAWADAQN
TVGMDLPNSPFKKYVGSFIGLGNRKAILNDSIPDSAKLYFAGHLLRQTRNPEGLIQILRRYFDVPVRIKE
YIPQWIFIDKSERSTLNGTVALGENCIIGAQVKDVQHKFRIQIGPIDRKKFESFFPGTKNAKQLIEWVRL
YIGYELAWDVQLILLDKYRGQTRLGKNALLGLSSFSGKNERKTDDFDELFIDYEARDRNKRHQDAIISTL
FQSDSEDEGEGEGIGASNPKSESKPKNESGSEGKSDLEGKGETKSASDPDSKGNGDSTS
 
Nucleotide Sequence: 1230 bp     [Download]
>gi|348589352|ref|NC_016043.1|:c81725-80496 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGAATAAGAGAGTATCAAAACTTCCACCTGACTATTGGTTAAATTTAGCTGAGTATCCTTATGATCACA
GCTTTTACCAAGTCATGCGCTATTTAGATGCGAAATTGCAGCTGCGCAAACCAATCGGCAGAAATATTTC
TCCTACACATGAGCCGTTCCGCATGAGGCAGGAACCGTCGATGATATTTGCACCTTCGAATTTAACTCGA
GTGGATATTCACGATAACGGCCGTCCTCCTACCATTTCGATTTTAGGCTTTGGTTTATGGGGTCCAAACG
GTCCTCTCCCGCTTCATCTCACTGAATATGCAAAAGAGCGGATTTACCATCATCGCGATAAGACATTATC
TGCATTCTCTGATATTTTCCATCATCGCTTAATCACTCTTTTTTATAGAGCTTGGGCGGATGCTCAAAAC
ACTGTAGGCATGGACCTACCAAATTCGCCTTTCAAAAAATATGTCGGTAGTTTTATTGGTTTAGGAAACC
GTAAAGCCATTCTTAACGACTCGATTCCTGATAGTGCGAAGCTATATTTTGCAGGCCATTTACTTAGACA
GACTCGCAATCCAGAGGGGCTTATACAAATTCTACGTCGCTATTTTGATGTGCCTGTTCGAATTAAGGAA
TATATCCCTCAATGGATCTTTATTGATAAAAGTGAACGTTCAACATTGAATGGTACAGTCGCGTTGGGGG
AAAATTGTATTATCGGTGCTCAAGTAAAAGATGTGCAGCATAAGTTCCGTATCCAAATCGGGCCAATTGA
TCGCAAAAAATTTGAATCTTTTTTCCCAGGCACAAAAAACGCTAAGCAACTTATAGAATGGGTTAGGCTT
TATATTGGATATGAATTAGCTTGGGATGTGCAGCTGATATTGCTTGATAAATACCGTGGACAGACCCGCT
TAGGCAAAAATGCTTTGCTTGGGCTTTCAAGCTTTTCGGGTAAAAATGAACGAAAAACTGATGACTTTGA
TGAGCTGTTTATCGATTATGAAGCCCGTGACAGAAACAAGCGACACCAGGATGCAATTATTAGCACGCTT
TTTCAGTCTGATTCCGAGGATGAGGGCGAGGGCGAAGGGATAGGTGCTTCAAATCCTAAGTCTGAGTCTA
AGCCTAAGAACGAATCCGGCTCCGAAGGCAAATCCGACCTCGAAGGCAAAGGCGAAACCAAATCCGCCTC
TGACCCCGATTCCAAAGGCAATGGCGATTCTACTTCCTAA
 Primer design