SecReT6
Protein ID: 348589434
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0082
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]81875..84721 [+]
ProductClpB protein
NoteTssH
UniProt IDG4QD56
KEGG IDtas:TASI_0082
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.90E-41, Aligned region: 228..307
AAA_2 [PF07724], Evalue: 2.90E-41, Aligned region: 675..841
AAA [PF00004], Evalue: 5.60E-21, Aligned region: 229..361
AAA [PF00004], Evalue: 5.60E-21, Aligned region: 681..765
ClpB_D2-small [PF10431], Evalue: 8.40E-17, Aligned region: 210..223
ClpB_D2-small [PF10431], Evalue: 8.40E-17, Aligned region: 848..926
AAA_5 [PF07728], Evalue: 2.80E-13, Aligned region: 229..252
AAA_5 [PF07728], Evalue: 2.80E-13, Aligned region: 354..396
AAA_5 [PF07728], Evalue: 2.80E-13, Aligned region: 680..798
AAA_16 [PF13191], Evalue: 2.80E-12, Aligned region: 206..250
AAA_16 [PF13191], Evalue: 2.80E-12, Aligned region: 274..308
AAA_16 [PF13191], Evalue: 2.80E-12, Aligned region: 506..506
AAA_16 [PF13191], Evalue: 2.80E-12, Aligned region: 671..719
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 181..194
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 229..309
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 371..395
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 679..702
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 742..765
AAA_19 [PF13245], Evalue: 1.70E-07, Aligned region: 227..251
AAA_19 [PF13245], Evalue: 1.70E-07, Aligned region: 677..702
AAA_19 [PF13245], Evalue: 1.70E-07, Aligned region: 790..803
Sigma54_activat [PF00158], Evalue: 1.80E-07, Aligned region: 223..245
Sigma54_activat [PF00158], Evalue: 1.80E-07, Aligned region: 678..795
AAA_14 [PF13173], Evalue: 1.80E-07, Aligned region: 180..202
AAA_14 [PF13173], Evalue: 1.80E-07, Aligned region: 229..309
AAA_14 [PF13173], Evalue: 1.80E-07, Aligned region: 335..395
AAA_14 [PF13173], Evalue: 1.80E-07, Aligned region: 679..775
NACHT [PF05729], Evalue: 4.30E-06, Aligned region: 229..266
NACHT [PF05729], Evalue: 4.30E-06, Aligned region: 680..707
AAA_25 [PF13481], Evalue: 1.20E-05, Aligned region: 212..253
AAA_25 [PF13481], Evalue: 1.20E-05, Aligned region: 677..706
AAA_17 [PF13207], Evalue: 2.10E-05, Aligned region: 229..249
AAA_17 [PF13207], Evalue: 2.10E-05, Aligned region: 473..481
AAA_17 [PF13207], Evalue: 2.10E-05, Aligned region: 679..717
AAA_29 [PF13555], Evalue: 4.20E-05, Aligned region: 221..245
AAA_29 [PF13555], Evalue: 4.20E-05, Aligned region: 678..703
IstB_IS21 [PF01695], Evalue: 5.20E-05, Aligned region: 213..250
IstB_IS21 [PF01695], Evalue: 5.20E-05, Aligned region: 680..700
IstB_IS21 [PF01695], Evalue: 5.20E-05, Aligned region: 790..812
Arch_ATPase [PF01637], Evalue: 6.20E-05, Aligned region: 179..195
Arch_ATPase [PF01637], Evalue: 6.20E-05, Aligned region: 208..249
Arch_ATPase [PF01637], Evalue: 6.20E-05, Aligned region: 281..313
Arch_ATPase [PF01637], Evalue: 6.20E-05, Aligned region: 555..592
Arch_ATPase [PF01637], Evalue: 6.20E-05, Aligned region: 679..712
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 228..250
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 560..596
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 670..720
NTPase_1 [PF03266], Evalue: 0.00075, Aligned region: 229..251
NTPase_1 [PF03266], Evalue: 0.00075, Aligned region: 280..306
NTPase_1 [PF03266], Evalue: 0.00075, Aligned region: 680..701
ResIII [PF04851], Evalue: 0.00083, Aligned region: 212..251
ResIII [PF04851], Evalue: 0.00083, Aligned region: 289..310
ResIII [PF04851], Evalue: 0.00083, Aligned region: 679..706
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 179..200
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 230..251
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 681..702
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 779..799
Hpr_kinase_C [PF07475], Evalue: 0.0033, Aligned region: 229..240
Hpr_kinase_C [PF07475], Evalue: 0.0033, Aligned region: 678..698
DAP3 [PF10236], Evalue: 0.0082, Aligned region: 219..241
DAP3 [PF10236], Evalue: 0.0082, Aligned region: 284..309
DAP3 [PF10236], Evalue: 0.0082, Aligned region: 661..718
T2SE [PF00437], Evalue: 0.009, Aligned region: 214..243
T2SE [PF00437], Evalue: 0.009, Aligned region: 675..749
ArsA_ATPase [PF02374], Evalue: 0.0091, Aligned region: 229..252
ArsA_ATPase [PF02374], Evalue: 0.0091, Aligned region: 418..450
ArsA_ATPase [PF02374], Evalue: 0.0091, Aligned region: 679..711
DUF815 [PF05673], Evalue: 0.0097, Aligned region: 220..304
DUF815 [PF05673], Evalue: 0.0097, Aligned region: 654..718
AAA_28 [PF13521], Evalue: 0.01, Aligned region: 230..304
AAA_28 [PF13521], Evalue: 0.01, Aligned region: 529..569
AAA_28 [PF13521], Evalue: 0.01, Aligned region: 680..700
Protein Sequence: 948 a.a.     [Download]
>gi|348589434|ref|YP_004873896.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MSDINRTDLFGKLNTLLYRSLEGATSFCKLRGNAFVELVHWLHQILHEHDSDLQKIIRHFDLRVETVERD
VVASLDELPRGASSVSDLSEHIDSATERAWVYGSLKYGDARIRSGYLILGILKTNSLRSVLYGISAEFKK
IIPDVLAEKLIDIVKNSAEEKDSVGLGQTSSGAPASASPQNSGKSALAQYAVDLTAKARNKEIDPVSGRD
EEIRQIVDILMRRRQNNPLLTGEAGVGKTAVVEGFALRLAKGDVPETLRDVTLYLLDIGLLQAGASMKGE
FESRLRSVIDEVQSSEKPIVLFIDEIHTLVGAGGAQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIE
KDPALTRRFQTVQVHEPSEEKALIMLRGISEPLENHHKVLLLDEAIEAAVRLSHRYIPARQLPDKAIALL
DTACARVAVSQYAEPAALEDTRRTIEYLSTEREIALREQKLGHDKAERLEEIDKELDVLEERQKELDAKW
TEEKELIKKIFDLRKIIQENTDLSRKKAKSIPTEPATKPESSEDAAKTQGAEGAEPSDDAKDKSDEANQQ
TEQMETQASEAPKGKKLSEKELDEVRKELRDVQHQLLEKQGEYPLIFPSVDANAVASVVADWTGIPVGRM
VKNEANSILTLADTLEKRVIGQRHGLEAIVKRIQTSRAKLTDPNKPVGVFLLTGPSGVGKTETALALAES
LYGGEQNLIIINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEVEKAHPDVHEIFF
QVFDKGFMEDGEGRYIDFKNTVIILTSNVGTDKIMDLCKDPDLMPDVEGLNNALREPLLKTFPAALLGRL
VVVPYFPLSDEMLGNIVKLQLRRIEKRLKENHNIDFKVTEDAIKQIVARCTQVESGGRMVDAILTNTVLP
NVSHKILEGTTQGKTITTLSLDAKDGEFVYDYTEVPNK
 
Nucleotide Sequence: 2847 bp     [Download]
>gi|348589352|ref|NC_016043.1|:81875-84721 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGTCAGATATCAATCGTACCGACCTCTTCGGCAAGCTAAACACCTTGTTATATCGCTCGCTCGAAGGAG
CTACTTCTTTTTGTAAACTCCGTGGCAATGCTTTTGTTGAGCTCGTCCACTGGCTTCATCAAATACTCCA
TGAGCATGACAGCGATTTACAGAAAATCATTCGTCATTTCGATTTAAGAGTCGAAACCGTAGAACGCGAT
GTCGTTGCCTCCCTAGATGAATTGCCTCGCGGAGCTAGCTCTGTTTCAGATCTCTCAGAGCATATCGATA
GTGCAACTGAGCGTGCTTGGGTTTACGGTTCTCTTAAATATGGTGATGCACGTATTCGAAGCGGTTATTT
GATTTTAGGTATTCTTAAAACTAATTCTTTGCGCTCTGTTCTTTATGGCATTAGTGCGGAATTCAAAAAA
ATAATTCCTGATGTTCTTGCAGAGAAACTTATCGATATCGTTAAAAATTCTGCTGAAGAGAAAGATTCAG
TAGGTCTTGGTCAAACTTCTTCAGGAGCTCCAGCTTCGGCTTCACCCCAAAATAGCGGAAAATCCGCACT
TGCTCAGTATGCAGTTGATTTAACAGCTAAAGCACGCAATAAAGAGATCGATCCAGTGTCAGGTCGTGAT
GAAGAGATTCGTCAAATTGTTGATATTCTTATGAGACGTCGCCAAAATAATCCACTTTTAACTGGTGAAG
CGGGTGTAGGTAAAACGGCTGTTGTTGAGGGTTTTGCTCTTCGCTTGGCTAAAGGTGATGTTCCTGAAAC
TTTACGTGATGTAACTTTATATTTGCTTGATATTGGCTTATTGCAAGCTGGTGCAAGTATGAAAGGGGAG
TTTGAATCACGTTTAAGATCAGTTATTGATGAGGTTCAATCAAGCGAAAAACCGATTGTTCTATTCATAG
ATGAAATTCACACATTAGTCGGTGCAGGCGGTGCTCAAGGAACTGGAGATGCAGCAAACTTGCTAAAACC
TGCTCTTGCACGTGGTCAATTAAGAACTATCGGTGCGACTACTTGGGCTGAATATAAAAAATATATCGAA
AAAGACCCTGCATTAACTCGTCGTTTCCAAACAGTTCAGGTTCATGAGCCATCTGAAGAGAAAGCACTTA
TCATGCTTCGTGGTATTTCTGAGCCATTAGAAAATCACCATAAAGTACTACTTTTGGATGAAGCTATTGA
GGCGGCTGTAAGACTATCACATAGATATATTCCAGCAAGACAATTGCCAGATAAAGCTATTGCCCTACTT
GATACTGCATGTGCACGCGTAGCAGTTAGTCAATATGCTGAACCAGCGGCTCTAGAAGATACAAGACGTA
CGATTGAGTATTTATCAACTGAACGTGAAATTGCACTACGTGAACAAAAATTAGGTCACGATAAGGCCGA
ACGTTTAGAAGAAATCGATAAAGAGCTAGATGTTCTTGAAGAGCGTCAAAAAGAACTTGATGCAAAATGG
ACTGAAGAAAAAGAATTGATTAAGAAAATTTTTGATCTTCGTAAAATTATTCAAGAAAACACTGACTTAT
CTCGCAAAAAAGCTAAAAGCATTCCAACAGAACCTGCTACTAAGCCTGAATCATCTGAAGATGCAGCTAA
GACTCAAGGTGCTGAAGGTGCTGAGCCTTCGGACGATGCTAAAGATAAATCTGATGAAGCTAATCAGCAA
ACAGAGCAAATGGAAACACAAGCTTCAGAAGCACCAAAAGGCAAAAAACTATCAGAAAAAGAGCTTGATG
AAGTACGTAAAGAACTTCGTGACGTACAACATCAACTTTTAGAAAAACAAGGCGAATATCCACTTATATT
CCCATCAGTAGATGCAAATGCTGTTGCTTCTGTTGTTGCTGATTGGACAGGTATTCCTGTAGGCCGTATG
GTTAAAAACGAAGCTAATTCTATCCTTACATTAGCCGATACACTTGAAAAACGCGTAATTGGCCAACGTC
ATGGTCTTGAGGCTATCGTTAAACGCATTCAAACATCTCGTGCCAAACTTACTGACCCTAATAAACCAGT
TGGTGTATTCCTACTAACTGGTCCTTCTGGTGTAGGTAAAACTGAAACAGCTCTTGCACTTGCTGAATCT
TTATATGGTGGTGAGCAAAACCTAATCATTATCAATATGTCAGAGTTCCAAGAAGCACATACAGTTTCAA
CTCTTAAAGGTGCTCCTCCAGGATATGTTGGTTATGGTGAGGGTGGTGTACTTACTGAAGCTGTACGTCG
ACGCCCTTACAGTGTTGTGCTTTTAGATGAAGTAGAGAAAGCCCATCCAGATGTTCATGAAATTTTCTTC
CAAGTATTCGATAAAGGATTCATGGAAGACGGAGAAGGTCGTTATATCGACTTCAAAAATACAGTTATTA
TCCTAACCTCAAATGTTGGTACAGATAAAATTATGGATCTTTGCAAAGACCCTGATTTAATGCCTGATGT
AGAGGGTTTAAATAACGCTTTGCGTGAGCCTTTGCTTAAAACATTCCCTGCAGCATTGTTAGGACGTTTA
GTGGTCGTTCCATATTTCCCACTTTCAGATGAAATGTTAGGAAATATCGTTAAATTACAACTGCGTCGTA
TCGAGAAACGCCTTAAAGAAAATCACAATATTGATTTCAAGGTTACCGAGGATGCTATTAAGCAAATCGT
TGCCCGTTGCACTCAAGTGGAATCGGGTGGTCGTATGGTGGATGCAATCTTAACTAATACAGTATTGCCA
AACGTATCACACAAAATTCTTGAAGGAACAACTCAAGGCAAAACAATCACAACTCTTTCACTAGATGCGA
AAGATGGTGAGTTTGTATATGACTACACAGAAGTTCCAAACAAATAA
 Primer design