SecReT6
Protein ID: 348589437
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0085
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]88157..88666 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDG4QD59
KEGG IDtas:TASI_0085
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.30E-33, Aligned region: 15..156
Protein Sequence: 169 a.a.     [Download]
>gi|348589437|ref|YP_004873899.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MKNLLRIFLVSLFATFVVACASTEKKLAVPYVVELSAATDSNPSNGRPSPIKIAVYELSSSDAFNQADFF
TLQQDYRKVLGDQVLGVKSEILSPGQTKELKFSGNLNSKHIGVIGYYKDFNSAKWKLLVDLPEAKTTNIY
KVWQRSPKSARIRIEAGAKELRVLPPVKK
 
Nucleotide Sequence: 510 bp     [Download]
>gi|348589352|ref|NC_016043.1|:88157-88666 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGAAAAATTTGTTACGGATATTCTTAGTTTCTTTATTTGCCACTTTTGTTGTGGCATGTGCATCTACAG
AGAAAAAACTAGCTGTGCCTTATGTTGTTGAATTATCTGCTGCAACTGATTCTAATCCTAGCAACGGAAG
ACCATCTCCTATCAAAATCGCTGTATACGAACTATCTAGTTCAGATGCATTTAATCAAGCCGACTTTTTT
ACTCTTCAACAAGATTATAGAAAAGTTTTAGGAGATCAAGTTTTAGGTGTTAAATCTGAAATTCTTTCTC
CAGGTCAAACTAAAGAACTTAAATTTTCTGGAAATTTAAATAGTAAACATATTGGTGTGATTGGCTATTA
CAAAGATTTCAACTCAGCAAAATGGAAATTATTAGTTGATCTACCAGAAGCTAAAACTACAAATATTTAT
AAAGTATGGCAGCGTTCTCCAAAAAGTGCTCGCATTAGAATCGAAGCGGGTGCAAAAGAATTACGTGTAT
TGCCACCTGTAAAAAAATAA
 Primer design