SecReT6
Protein ID: 348589438
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0086
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]88679..90028 [+]
Productprotein ImpJ/VasE
NoteTssK
UniProt IDG4QD60
KEGG IDtas:TASI_0086
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-118, Aligned region: 19..442
Protein Sequence: 449 a.a.     [Download]
>gi|348589438|ref|YP_004873900.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MSISNKVIWSEGMFLRPQHFQQQDRYLDSKQRVLLEASPTYYWGFYQLEIDQNALKENKLAITKAAGIFK
DGTPFSLNGNDVPMLPLDSFAREEMIYLVLPSKEASRQEVSYEEGSDLLARFSVVETTLSDVSDITLGEA
PVQIGKPQFKFMPDSEIDGNWVKLPVVHFKGKNKLNIVEVDTGFIQPTINCAFVNNPITDHLSRVVDLLN
LRSTELSKRFNPNNRTSASTTYETIILGIVNRNLILFKHLYTLEYLHPEVFFRYLSMLVAELAMFHPDSI
SINKIPSYDHDALKVPLENLMSQIGDALNIVFEDAYVTIPLEDKGHGLSVGKVPDKNLFAKSQFVLAVKA
DLPGESVRKTFPQQAKLGPTNRMRDLVHLQLPGITLEHMDQVPAALPYHAGYIYFNLVKEGDMWNQFEKS
STLALHLAGDYPGLDMQFWAVKNTDKRNS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|348589352|ref|NC_016043.1|:88679-90028 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGAGCATAAGTAATAAAGTTATTTGGTCTGAGGGCATGTTTCTGCGCCCTCAGCATTTTCAACAACAAG
ATAGATACCTAGACTCTAAGCAAAGAGTTCTTCTTGAAGCTTCCCCAACCTACTATTGGGGCTTTTATCA
ATTAGAGATTGATCAAAATGCACTTAAAGAAAACAAGTTAGCTATTACTAAAGCTGCAGGTATTTTTAAA
GACGGAACTCCATTCTCTTTAAACGGAAATGATGTTCCGATGCTTCCATTAGATTCTTTTGCACGTGAAG
AGATGATTTATTTGGTTCTTCCATCTAAAGAGGCTTCTCGTCAAGAAGTTTCATATGAAGAAGGAAGTGA
TTTGCTCGCTAGATTTAGTGTTGTTGAAACTACTTTAAGTGACGTATCTGATATTACTTTAGGTGAGGCA
CCAGTTCAAATTGGTAAGCCTCAGTTTAAATTTATGCCTGATTCAGAAATTGACGGAAATTGGGTAAAAC
TTCCTGTAGTGCATTTTAAAGGTAAAAATAAACTTAATATTGTTGAAGTTGATACTGGGTTTATCCAACC
GACAATAAATTGTGCTTTCGTAAATAATCCAATTACCGATCATTTATCAAGAGTTGTGGATTTACTAAAC
CTAAGATCTACAGAACTTTCAAAACGGTTTAACCCTAATAATAGAACTTCAGCTAGTACAACTTATGAGA
CTATTATTTTAGGTATTGTAAATAGAAACCTAATTCTATTTAAACATCTATATACACTTGAATATCTGCA
TCCAGAAGTATTTTTTAGATATTTATCTATGCTTGTGGCTGAGCTTGCTATGTTCCATCCAGATAGCATC
TCTATCAATAAAATTCCTTCATATGACCATGATGCTTTAAAAGTGCCTCTAGAAAATTTGATGAGCCAAA
TCGGCGATGCACTTAATATCGTATTCGAAGATGCTTACGTTACTATCCCACTCGAAGACAAAGGTCATGG
ACTTAGTGTCGGGAAAGTTCCAGATAAAAATCTATTCGCAAAATCACAATTTGTACTTGCGGTCAAAGCC
GATTTGCCAGGGGAGTCTGTACGCAAAACATTCCCTCAACAGGCGAAATTGGGACCTACAAACCGTATGC
GAGATCTTGTACATCTACAACTACCTGGCATTACGCTTGAGCATATGGATCAAGTTCCGGCAGCATTGCC
ATATCATGCAGGATATATCTACTTTAATTTAGTTAAAGAAGGCGATATGTGGAATCAATTTGAAAAATCA
TCAACACTAGCCCTTCATCTAGCAGGAGATTATCCAGGCCTTGATATGCAATTCTGGGCTGTAAAAAACA
CTGATAAACGTAATTCTTAG
 Primer design