SecReT6
Protein ID: 348589439
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0087
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]90039..91376 [+]
Productouter membrane protein ImpK/VasF
NoteTssL
UniProt IDG4QD61
KEGG IDtas:TASI_0087
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-68, Aligned region: 39..244
DUF2077 [PF09850], Evalue: 3.10E-68, Aligned region: 379..410
OmpA [PF00691], Evalue: 7.90E-19, Aligned region: 311..409
Protein Sequence: 445 a.a.     [Download]
>gi|348589439|ref|YP_004873901.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MSSRDYVDSKMGPWGQIHQQRYDESNKIRPDNFVISGSNPLVAAANPLLTLLPQIRFSQHHDNVDMLREL
LVEEVRQFEVRAQEKGISKETILGARYCLCTAIDEACAMAPWGQQGLWSGKSLLVTYHNETWGGEKFFQL
LRKLSQNPENHIDLLELMYFCLMLGFEGRFRVIENGRSQLETLKQRLLLIIKKVRGSYPITLSPNWKGDE
IINKIKRLPIPLWVVAIFGFALAVLSYILFSWLLGGKSDEVAYDIVKIKPPAMQIAVPVRVVRQEAPKRL
AQFLEAEIRENLMTVRDESDRSVVELRGDELFESGSAEIKKKFETVVNRLGDALDETEGNILITGHTDNR
PIKTIRFPSNWDLSQARADAVAKIIESRLTQKNRIRAEGKADTMPVKPNDTAENRARNRRVEITLLIPAQ
TKKARPTTPYIVPTPDGTKTINPDQ
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|348589352|ref|NC_016043.1|:90039-91376 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGTCTTCTAGAGATTATGTTGATTCTAAGATGGGGCCGTGGGGTCAAATCCACCAGCAACGTTATGATG
AATCAAACAAAATAAGACCCGATAATTTTGTAATTAGCGGTTCAAATCCACTTGTAGCAGCGGCTAATCC
GCTGCTCACCCTATTGCCACAAATCCGCTTCTCTCAACATCACGATAACGTTGATATGTTGCGTGAGTTG
CTCGTTGAGGAGGTTCGTCAATTTGAGGTTCGAGCTCAAGAAAAGGGTATTAGTAAAGAAACAATTCTTG
GAGCTAGATATTGTCTATGTACAGCTATAGACGAGGCTTGTGCAATGGCTCCTTGGGGGCAGCAAGGCTT
ATGGTCTGGTAAAAGTTTGCTTGTCACCTACCATAATGAAACATGGGGTGGAGAAAAATTCTTCCAGCTT
TTAAGAAAACTCTCTCAGAACCCAGAAAATCATATTGATCTTCTTGAACTTATGTATTTTTGTTTGATGT
TAGGTTTTGAGGGGCGTTTCAGAGTTATTGAAAATGGCCGCTCTCAACTTGAGACCTTAAAACAAAGGCT
TCTTCTTATTATTAAAAAAGTAAGGGGTTCATATCCAATTACTCTCTCTCCTAATTGGAAGGGTGACGAG
ATTATCAATAAGATTAAACGTTTACCAATTCCATTGTGGGTGGTTGCTATTTTTGGGTTTGCTCTTGCAG
TATTATCGTACATTTTATTCTCTTGGTTGCTTGGCGGAAAATCAGATGAAGTTGCCTACGATATCGTTAA
AATTAAACCACCAGCTATGCAAATTGCGGTTCCAGTTAGGGTTGTTCGTCAAGAAGCACCGAAGCGTTTA
GCTCAGTTCCTAGAAGCTGAAATCCGCGAGAATTTAATGACTGTACGAGATGAATCAGACAGAAGTGTAG
TTGAATTACGCGGTGACGAATTATTTGAATCTGGTTCAGCAGAAATTAAGAAAAAATTTGAAACTGTCGT
TAACCGACTTGGTGATGCTTTAGACGAGACGGAAGGAAATATTCTGATTACGGGTCACACGGATAATAGA
CCTATCAAGACTATTAGATTCCCATCAAACTGGGACTTATCACAAGCTAGGGCAGACGCAGTTGCAAAAA
TTATTGAGTCTCGTTTGACCCAGAAAAATCGTATAAGAGCTGAAGGTAAGGCTGACACTATGCCAGTTAA
ACCGAATGATACAGCCGAAAATAGGGCTAGAAATCGTCGTGTTGAAATTACATTGTTAATTCCAGCTCAG
ACTAAGAAAGCTCGTCCAACAACCCCTTATATAGTCCCAACACCAGATGGTACTAAGACTATTAATCCTG
ATCAGTAA
 Primer design