SecReT6
Protein ID: 348589440
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0088
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]91553..95014 [+]
ProductIcmF-like protein
NoteTssM
UniProt IDG4QD62
KEGG IDtas:TASI_0088
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.70E-90, Aligned region: 157..423
ImcF-related_N [PF14331], Evalue: 1.70E-90, Aligned region: 1007..1023
IcmF-related [PF06761], Evalue: 1.20E-79, Aligned region: 177..213
IcmF-related [PF06761], Evalue: 1.20E-79, Aligned region: 474..782
DUF1215 [PF06744], Evalue: 3.70E-33, Aligned region: 893..1015
Protein Sequence: 1153 a.a.     [Download]
>gi|348589440|ref|YP_004873902.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MYLIIAIFALYFLRLFWRKYREGRLNAKLLGQLKSNKPKDTEKLTEKEREEVRVLSERFNEAITLLKQSR
FEKGKDKSFSARFSKQYLYQLPWYVFIGAPGSGKTTALVNSGLNFPLAEKFGRMALKGVGGTRNCDWWFT
DEAVLLDTAGRYTTQDSNAATDEDEWKGFLKLLTKYRARQPINGVMLTVSVYDLLASTQEERAKHAVALK
KRLQELRDELGTEFPVYILVTKMDQLHGFEDYFDNLSVEEHQQVWGFTFPYEESQKDGFDFYEEYEKEFQ
VLQERLFDGLPDLLMKNRNLESSSLAYLLPQQFANLRIVLGTFLTDVFSFSRLESKIVPRGVYFTSGTQG
GVSFDKVSEELKDYLQIDGISQHNKAPMLEGGKSYFLTDLLQNLIFKESGLAGVNLKWEKRYRQIQWIGY
GLVGLLLLGALTLWFNSYRNNSRYLDFVEEKLPVVQNHSNNIKISESGDVFSILPYLSLVKKLPNGENFL
VDDAPFSYGFGLYQGGKVKSASRSIYDDAIHQVFAPQIAKRIEKRLATMSDANIVIYYEALRAYLMMYEP
EHYDKDYFTQWVLHDVVADKSAQFNNEQFQLLREHMDYLFGQGAFVSPFPLNEELVQEARNRIDSHDLAQ
RAYLRAREILKQDPKNDVTLMTLAGNQASTVFRRKSGDALNRGVNRIFSYEGYWNIFNKNIEKISIQLRE
DDEWILGIDNTTFADGSANKLLNEVKKLYFVDYIREWDAFLADIEVIPPKNLSHAIELSRSMSSTNSPLT
KFVKGVAGDTTLLREDVNFQRTLVDRATESASSMASSLTSLMGPLDTGDLIKGKEEPTKLESMVDNHFIG
YHELAVSAGNNTPAPIEGTIDLIEELYNFLTASETALRTKVTLPSQEVISKLQAESGRLPPVVGSMLTSI
TTEASKAINSGAQANIGADINAQIGMSCRNSITNRYPFRSTTRDVAPNDFARFFAPNGLMDQFFNKNLIN
MVDMSKRPWRFKPGVDGSKGNIAKYLSSFEKASVIRDVYFAGGKPEPSFKVSIRPVEMDANITQMVLNID
GQTLTYEHGPQVGKSFDWPGQGSNQVSITLSPHDGTSSLTTNGPWALNRLIDNAKISRGRSPEVIFATFN
IGGRSVKLEITANSAKSPFRLGEMRSFVCPGVN
 
Nucleotide Sequence: 3462 bp     [Download]
>gi|348589352|ref|NC_016043.1|:91553-95014 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGTACTTAATCATTGCCATCTTTGCGTTGTATTTTCTTAGATTATTCTGGAGAAAATATCGTGAGGGGC
GTTTGAATGCAAAACTTTTGGGACAGCTCAAAAGCAATAAGCCTAAAGATACCGAAAAACTTACCGAAAA
AGAACGCGAAGAAGTACGTGTTTTATCTGAACGGTTTAACGAAGCAATTACATTACTAAAACAATCACGA
TTTGAAAAAGGGAAGGACAAATCGTTTTCAGCTAGATTTTCTAAGCAATATTTATATCAATTGCCTTGGT
ATGTTTTTATTGGAGCACCAGGTTCAGGGAAAACTACTGCATTAGTAAATTCAGGTTTAAATTTCCCATT
GGCTGAAAAATTCGGTCGTATGGCGCTCAAAGGTGTGGGTGGTACGAGAAACTGTGATTGGTGGTTTACT
GATGAAGCGGTTCTACTTGATACTGCTGGAAGATACACAACTCAGGATAGTAATGCTGCTACTGATGAAG
ACGAGTGGAAGGGATTCTTAAAACTTCTTACTAAATATAGAGCTAGGCAGCCTATCAATGGCGTGATGCT
TACTGTCAGTGTGTATGATTTGCTTGCATCAACTCAAGAAGAGCGTGCTAAACATGCTGTAGCCCTTAAA
AAACGTTTGCAGGAACTAAGAGATGAATTGGGGACAGAGTTCCCTGTTTATATTTTGGTTACTAAGATGG
ACCAATTACACGGGTTTGAAGATTATTTCGATAATTTAAGTGTAGAAGAACATCAACAAGTTTGGGGATT
TACATTTCCATACGAAGAGTCTCAAAAGGATGGTTTCGATTTTTATGAAGAATACGAGAAAGAATTCCAG
GTTCTTCAAGAGCGTTTATTTGATGGGCTTCCAGACTTATTAATGAAAAATCGAAATCTGGAAAGTAGTT
CCTTGGCGTATTTATTGCCACAGCAATTTGCAAACTTAAGAATTGTTTTAGGTACTTTCTTAACGGATGT
ATTTTCTTTTAGTCGCCTTGAATCGAAAATTGTCCCTCGTGGCGTTTATTTCACAAGCGGAACGCAAGGT
GGTGTAAGTTTCGATAAGGTTAGTGAAGAACTTAAAGACTACCTTCAAATCGATGGTATTTCTCAACATA
ATAAAGCACCGATGTTAGAAGGCGGAAAGAGCTACTTCTTAACTGATCTACTTCAAAATTTGATTTTCAA
GGAATCAGGTCTTGCGGGCGTAAACCTTAAATGGGAAAAACGCTATCGCCAGATTCAGTGGATTGGGTAT
GGCTTAGTTGGGTTACTACTTTTAGGTGCGTTAACTCTTTGGTTTAATAGCTATCGAAATAACTCACGAT
ATCTTGATTTTGTAGAAGAGAAGCTGCCAGTTGTTCAAAATCATAGTAACAATATTAAGATCTCTGAAAG
CGGCGATGTGTTTAGCATATTGCCATATTTGAGTCTTGTGAAAAAACTGCCTAACGGAGAGAATTTCTTA
GTTGATGATGCTCCGTTCTCATATGGTTTTGGTCTATATCAAGGCGGAAAAGTTAAGTCTGCTTCTCGTT
CTATATACGACGATGCTATTCATCAAGTATTTGCTCCACAAATTGCAAAACGCATAGAGAAACGATTAGC
AACCATGAGCGATGCAAATATCGTTATTTATTATGAGGCGTTGCGTGCATATTTAATGATGTATGAACCT
GAACATTACGATAAAGATTACTTTACTCAATGGGTTCTGCATGATGTTGTAGCTGATAAATCGGCTCAAT
TTAATAATGAGCAATTCCAGCTTTTAAGAGAACATATGGATTACCTCTTTGGTCAGGGTGCATTTGTATC
ACCATTTCCACTTAATGAAGAGTTAGTTCAAGAAGCACGAAATCGTATCGATTCACATGATTTGGCTCAA
CGTGCGTATCTTCGTGCTCGTGAAATCCTAAAACAAGATCCTAAAAACGATGTAACTTTGATGACTCTTG
CGGGTAATCAAGCATCCACAGTATTTAGACGCAAAAGCGGTGATGCTTTAAATCGTGGCGTTAATAGAAT
CTTCTCATACGAAGGATATTGGAATATTTTTAATAAAAATATTGAAAAAATATCCATCCAATTAAGAGAA
GATGACGAGTGGATATTGGGTATAGATAACACCACATTTGCCGATGGTAGTGCAAACAAACTTCTTAATG
AGGTTAAAAAACTCTACTTTGTAGATTACATTCGTGAGTGGGATGCGTTTTTGGCTGACATCGAAGTTAT
TCCTCCTAAAAACTTAAGTCATGCAATTGAATTGTCCCGTAGTATGTCTTCTACCAACTCGCCTCTTACT
AAATTCGTTAAAGGGGTAGCGGGTGATACAACCCTTTTGCGTGAAGACGTTAATTTCCAAAGAACTCTTG
TAGATAGAGCTACTGAAAGTGCTTCAAGTATGGCTTCTTCATTGACATCTTTGATGGGTCCACTTGATAC
TGGTGATCTCATTAAAGGGAAAGAGGAACCTACCAAATTAGAGTCTATGGTGGATAATCACTTTATTGGT
TATCACGAATTGGCTGTCAGTGCGGGAAATAACACACCTGCTCCAATCGAGGGGACGATTGATCTAATTG
AAGAGTTATATAACTTTTTGACGGCGTCAGAAACAGCTTTGCGGACTAAGGTAACATTGCCATCGCAAGA
AGTAATTTCAAAACTTCAAGCAGAGTCTGGACGTCTACCACCAGTTGTGGGCAGTATGCTTACATCAATC
ACAACAGAAGCTTCTAAAGCTATTAACTCTGGAGCTCAAGCGAATATCGGTGCGGATATTAATGCACAGA
TTGGTATGTCTTGCAGAAACTCTATCACTAACAGATATCCATTTAGATCTACCACTCGCGATGTTGCACC
TAATGATTTTGCAAGGTTTTTCGCTCCAAATGGCTTAATGGATCAATTCTTTAATAAGAATTTAATCAAT
ATGGTGGATATGTCTAAGCGTCCATGGCGATTTAAACCAGGGGTAGATGGCTCGAAAGGGAACATTGCCA
AATACTTATCTTCTTTTGAGAAAGCTTCTGTAATTCGTGATGTTTATTTCGCAGGCGGCAAACCTGAACC
TTCGTTTAAAGTTTCAATACGTCCTGTAGAGATGGATGCAAACATTACGCAAATGGTACTTAATATTGAT
GGTCAGACATTGACTTATGAGCATGGTCCTCAAGTAGGCAAATCTTTTGATTGGCCTGGTCAGGGAAGCA
ATCAAGTTTCAATTACTTTAAGCCCTCATGATGGAACTTCATCTCTTACAACTAACGGGCCGTGGGCTCT
TAATCGACTGATAGATAATGCGAAGATTTCGCGTGGTCGTTCCCCTGAGGTTATTTTTGCTACATTCAAC
ATAGGTGGTAGATCTGTGAAATTAGAAATCACTGCTAACTCCGCAAAAAGCCCATTTAGATTGGGCGAGA
TGCGAAGCTTCGTTTGCCCAGGAGTGAACTAG
 Primer design