SecReT6
Protein ID: 348589443
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0091
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]98677..99744 [+]
Productprotein ImpA
NoteTssA
UniProt IDG4QD65
KEGG IDtas:TASI_0091
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.90E-13, Aligned region: 52..111
Protein Sequence: 355 a.a.     [Download]
>gi|348589443|ref|YP_004873905.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MMNFDELFPSFDNDDCGLNLEYDSDFLNLVQASQAKPEQQFGDAVIEAQPPDWAKVEKMALELCKRSCDV
RVLQVLTYAWTFQLGLVGYAQGVNLVHQALEKCWDAVNPPLVEEDGYEDPMPRVNAISALGDVSTVGRDI
RNSKLLTENYGNLTVREAEAILEGNTEGFPGGKNRLSEMLSQANQAENPIVQAIPVAFNAMKGIEDLVVE
KLGHEWRPDFQTIKSLFGSFVQLINSDISSSDSDLDSGDSSSESSRESDSLVDSGSDSTAKFASWREVQI
KTRADAILALEKACAYFEVHEPSHPAPFIIRRLQQAIPLNFFDMLKNLAPSGSEQFEQTWIPRTEEETSG
SSDEY
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|348589352|ref|NC_016043.1|:98677-99744 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGATGAATTTTGATGAGTTATTTCCCTCATTCGATAACGATGATTGTGGGTTAAATCTTGAGTATGATT
CAGATTTTTTGAATCTAGTTCAAGCCTCACAAGCTAAGCCTGAACAACAGTTCGGAGATGCCGTAATCGA
AGCTCAACCCCCTGATTGGGCCAAAGTTGAAAAAATGGCATTGGAATTATGCAAGCGTTCATGTGATGTT
CGTGTGTTGCAGGTTCTTACATATGCTTGGACTTTTCAACTTGGTCTAGTTGGTTATGCTCAGGGAGTTA
ACTTAGTTCATCAAGCTTTGGAGAAGTGTTGGGATGCCGTTAATCCTCCTCTTGTTGAAGAAGATGGTTA
TGAAGATCCAATGCCTCGCGTTAATGCAATCTCTGCATTAGGTGATGTATCTACTGTTGGTAGGGATATT
CGTAATTCTAAGCTTCTTACCGAGAATTACGGGAATCTAACAGTTCGTGAAGCTGAAGCTATATTGGAAG
GGAATACTGAAGGATTCCCAGGCGGTAAAAACAGATTATCTGAGATGTTGTCTCAAGCTAATCAAGCTGA
AAATCCTATTGTACAGGCCATTCCAGTAGCTTTTAATGCCATGAAAGGCATTGAGGATTTAGTAGTTGAA
AAGTTGGGCCATGAGTGGCGTCCAGATTTTCAAACTATTAAGTCTTTATTTGGTTCGTTTGTTCAACTAA
TTAATTCTGACATTAGTTCAAGCGATTCTGATTTAGATTCAGGCGATAGTTCATCTGAATCTTCTCGTGA
ATCGGATTCTTTAGTTGACTCGGGTTCTGATTCTACAGCTAAGTTTGCCTCTTGGCGTGAAGTTCAGATT
AAAACTAGGGCGGATGCGATATTGGCGCTCGAAAAGGCTTGTGCTTATTTTGAAGTTCATGAGCCTAGTC
ATCCAGCGCCATTTATTATTCGTAGATTACAACAAGCGATACCTCTTAATTTCTTTGATATGCTTAAAAA
CCTTGCACCGTCAGGTTCTGAGCAGTTTGAACAAACCTGGATACCTCGCACTGAAGAGGAAACAAGTGGT
TCATCGGATGAATATTAA
 Primer design