SecReT6
Protein ID: 348589444
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0092
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]99782..100315 [+]
Productprotein ImpB
NoteTssB
UniProt IDG4QD66
KEGG IDtas:TASI_0092
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.10E-60, Aligned region: 12..165
Protein Sequence: 177 a.a.     [Download]
>gi|348589444|ref|YP_004873906.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MGSRSKSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMAVMSDLTGKSTVEQADINERKFSEIDVDN
FDDRMKAIAPRVDISVPNTLTGEGRMYVDLTFNSMDDFNPANIARNVEPLAKLLEARTELSNLLTYMDGK
SGAEQLINKVLENPALLKSLAAAPNKSSSDEAQQDQE
 
Nucleotide Sequence: 534 bp     [Download]
>gi|348589352|ref|NC_016043.1|:99782-100315 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGGGCTCAAGAAGCAAAAGTGGTCAAAAATTTATTGCACGCAACCGTGCACCACGCGTACAAATCGAGT
ATGACGTAGAGATTTACGGTGCTGAGCGTAAAATCCAACTTCCATTTGTTATGGCAGTTATGTCTGATTT
GACTGGTAAATCAACTGTTGAGCAAGCCGATATTAATGAGCGTAAATTTAGTGAAATCGATGTAGATAAT
TTTGATGATCGCATGAAAGCTATCGCTCCTCGCGTTGATATTTCTGTTCCTAATACTCTTACAGGTGAAG
GCAGAATGTATGTTGACTTAACTTTCAACAGTATGGACGACTTTAACCCAGCAAATATTGCAAGAAACGT
TGAGCCATTAGCAAAATTATTAGAAGCTAGAACTGAGCTTTCTAATCTATTAACTTATATGGACGGTAAG
TCTGGTGCAGAACAATTAATTAATAAAGTTCTTGAAAATCCAGCTTTACTTAAATCATTAGCAGCTGCGC
CAAACAAATCTTCATCTGATGAAGCGCAACAAGATCAAGAGTAG
 Primer design