SecReT6
Protein ID: 348589445
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0093
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]100324..101817 [+]
Productprotein ImpC
NoteTssC
UniProt IDG4QD67
KEGG IDtas:TASI_0093
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.20E-197, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|348589445|ref|YP_004873907.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MATEALKQGQEKGTLEVEGLSSLLKKEFKPKTEEAQSAVESAVKTLAEQALSSAVTISSDSYITIQNIIA
EIDRKLSQQINVILHNEEFQKLEGAWRGLHYLVSNTETDELLKIRFMPITKKELGRTLKRHKGTAWDQSP
IFKRIYEEEYGQFGGEPIGCIVGDYHFDHSPPDVELLGEMAKIAAAAHCPFISGADPSLMQMDSWQELSN
PRDLSKIFTNTEYAAWRSLRETDDARYLGLTLPRFLARLPYGARTNPVDEFDFEEDTEGANHNNYTWANS
AYAMATNINRSFKEYGWCTSIRGVESGGAVEGLPTHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMP
LVHRKNSDFAAFIGAQSLQKPAEYDDPDATANARLAARLPYLFACCRFAHYLKCIVRDKVGSFTSRNEME
DWLNTWIMNYVDGDPANSSQETKARKPLAAAEVQVAEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSKL
PSLKKGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|348589352|ref|NC_016043.1|:100324-101817 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGGCTACTGAAGCTTTAAAACAAGGTCAAGAGAAAGGTACTCTAGAGGTTGAAGGTTTATCTTCACTTC
TTAAAAAAGAATTTAAACCTAAGACTGAAGAAGCACAAAGTGCAGTTGAAAGTGCCGTTAAAACTCTTGC
AGAGCAAGCACTTTCTTCAGCTGTTACCATCTCTTCAGATTCATATATCACTATTCAAAATATTATTGCT
GAGATTGATCGTAAATTATCTCAACAGATTAACGTTATTCTTCATAATGAAGAGTTCCAAAAATTAGAAG
GTGCGTGGCGTGGTCTTCACTACTTAGTGTCTAACACAGAAACAGATGAATTATTAAAAATCCGTTTCAT
GCCAATCACTAAAAAAGAGCTTGGCCGTACACTTAAACGTCATAAAGGTACAGCTTGGGATCAAAGCCCT
ATTTTCAAACGTATTTATGAAGAAGAGTACGGTCAATTCGGTGGTGAACCAATAGGTTGTATCGTAGGTG
ACTATCATTTTGATCATAGTCCTCCTGATGTTGAATTGCTTGGTGAGATGGCTAAGATTGCTGCCGCTGC
TCACTGCCCATTTATCTCTGGTGCAGACCCATCATTAATGCAGATGGATTCTTGGCAGGAACTTTCTAAC
CCACGTGATCTAAGCAAAATCTTTACAAATACTGAGTATGCTGCTTGGAGAAGTTTGCGTGAAACTGATG
ACGCACGTTACTTAGGTTTAACTTTACCTCGTTTCCTAGCTCGTCTGCCATACGGTGCTCGTACAAATCC
AGTAGATGAGTTCGATTTTGAAGAAGATACTGAGGGAGCTAACCACAACAATTACACTTGGGCTAACTCT
GCATATGCAATGGCTACAAATATTAACCGTTCATTCAAAGAGTATGGTTGGTGTACATCTATCCGTGGTG
TAGAGTCAGGAGGTGCTGTAGAAGGCTTGCCTACTCATACTTTCCCAACAGATGATGGTGGCGTTGATAT
GAAATGCCCTACTGAAATTGCTATCAGTGACCGTCGTGAAGCCGAACTAGCTAAAAATGGATTTATGCCA
CTAGTTCACCGTAAGAATTCAGACTTTGCTGCATTTATTGGAGCTCAGTCATTACAAAAGCCTGCTGAAT
ATGATGACCCAGATGCTACAGCAAATGCTCGTCTAGCAGCTCGTTTACCTTATTTATTTGCATGCTGCCG
TTTCGCTCACTACTTAAAATGTATTGTCCGCGATAAAGTGGGTTCATTTACATCACGTAATGAGATGGAA
GATTGGTTAAATACTTGGATTATGAATTATGTTGATGGAGATCCAGCTAACTCATCTCAAGAAACTAAAG
CACGTAAACCACTTGCAGCTGCTGAAGTGCAAGTTGCGGAAATCGAAGATAATCCTGGCTATTATGCAGC
TAAATTCTTCTTGCGTCCGCATTACCAGTTAGAGGGTTTAACCGTTTCATTAAGGTTAGTCTCTAAATTG
CCATCTCTTAAAAAGGGTGGCTAA
 Primer design