SecReT6
Protein ID: 348589446
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0094
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]101886..102371 [+]
Productprotein ImpD
NoteTssD
UniProt IDG4QD68
KEGG IDtas:TASI_0094
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.40E-36, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|348589446|ref|YP_004873908.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MAVDMFLKISSVEGESKDSKHAKWTDIESFAWGATQPGSMATGGGGGTGKASFNDLHVICRIDRAAPTVM
KHCATGKHLDKVEVSVNKAGGEQVEYSKITLEDVLVTSVQYTGEKDGDAMMVSYSFQGAKVKQQYWEQSE
KGTKGAESVVGYDIKQNKATA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|348589352|ref|NC_016043.1|:101886-102371 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGGCTGTTGATATGTTTTTGAAAATTTCTAGCGTAGAAGGTGAATCTAAAGATTCTAAACATGCAAAAT
GGACTGACATCGAATCATTCGCTTGGGGTGCTACTCAACCTGGTTCTATGGCTACTGGCGGTGGCGGCGG
TACTGGTAAAGCTAGCTTCAACGACCTTCATGTTATTTGCCGCATCGACCGTGCTGCACCTACAGTAATG
AAACATTGTGCTACTGGTAAACACTTAGACAAAGTTGAAGTTTCTGTAAACAAAGCAGGTGGCGAACAAG
TTGAATACTCTAAAATCACTTTAGAAGACGTTCTTGTTACTTCAGTTCAATACACTGGCGAAAAAGATGG
CGACGCTATGATGGTTAGCTACTCTTTCCAAGGTGCTAAAGTTAAACAACAATACTGGGAGCAATCAGAA
AAAGGTACTAAAGGTGCTGAATCTGTTGTTGGTTACGACATCAAACAAAATAAAGCTACTGCTTAA
 Primer design