SecReT6
Protein ID: 348589447
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0095
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]102465..103298 [+]
Producthypothetical protein
NoteTagJ
UniProt IDG4QD69
KEGG IDtas:TASI_0095
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.90E-35, Aligned region: 141..266
TPR_19 [PF14559], Evalue: 0.00072, Aligned region: 24..59
TPR_19 [PF14559], Evalue: 0.00072, Aligned region: 107..128
TPR_11 [PF13414], Evalue: 0.0081, Aligned region: 26..56
TPR_11 [PF13414], Evalue: 0.0081, Aligned region: 108..128
Protein Sequence: 277 a.a.     [Download]
>gi|348589447|ref|YP_004873909.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MNTAGIFKTNSIQDIIEQTKDKVRKNPGSADLRANLFQLLSLKGDWTKAVDSLKLSAEMNSQAQPVAMLY
VAAVNAEVDRQNVFKGNGRPSIFGDADEWMGYLITSIEEQDPAKSEELLDQAMELAPEVSGTITTRNGEE
IKFEWLADGDSRLGPMLEFLNNGQYGWVPFNEIQSLRIIEPSGISDLIWSQAELVLSNGRSIVGMVPNRY
PGDYANLEDSFNLGHRTEWQPLYENSESEFYKGVGQKTYMSDVGDHPILEIESIKFNPVQVQDSEEA
 
Nucleotide Sequence: 834 bp     [Download]
>gi|348589352|ref|NC_016043.1|:102465-103298 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGAACACTGCTGGAATTTTTAAAACTAATTCAATTCAAGACATTATTGAACAAACTAAAGACAAAGTTC
GTAAGAATCCTGGGAGTGCTGATTTGCGTGCAAATTTATTTCAGCTCTTATCCTTAAAGGGAGACTGGAC
TAAGGCTGTAGATAGCCTAAAACTAAGTGCTGAGATGAATTCGCAAGCTCAACCAGTAGCTATGTTATAT
GTAGCTGCGGTAAATGCTGAGGTTGATCGTCAGAATGTTTTTAAAGGAAATGGTAGACCATCAATTTTCG
GTGACGCTGATGAGTGGATGGGTTATTTAATAACTTCTATTGAAGAGCAGGACCCTGCAAAATCTGAGGA
ATTGCTTGATCAGGCTATGGAATTAGCTCCTGAAGTATCAGGAACTATCACCACAAGAAATGGTGAAGAA
ATCAAGTTTGAGTGGCTTGCTGACGGTGATAGTAGATTAGGTCCAATGCTTGAATTTTTAAATAACGGTC
AGTACGGATGGGTACCGTTTAACGAAATTCAATCCTTAAGAATAATTGAACCTTCTGGTATTTCGGATCT
TATCTGGTCTCAAGCAGAACTTGTTTTAAGCAATGGTCGTTCTATTGTTGGAATGGTACCGAATCGCTAT
CCAGGCGATTATGCAAATCTTGAAGATTCTTTTAATTTAGGGCATAGAACCGAGTGGCAGCCTCTGTATG
AAAATTCTGAATCAGAATTTTATAAAGGTGTCGGTCAAAAAACATATATGTCAGATGTTGGTGATCACCC
AATTCTAGAAATTGAATCTATTAAATTTAATCCAGTTCAAGTTCAGGATTCAGAAGAAGCCTAA
 Primer design