SecReT6
Protein ID: 348589448
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0096
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]103308..103871 [+]
Productprotein ImpF
NoteTssE
UniProt IDG4QD70
KEGG IDtas:TASI_0096
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.60E-17, Aligned region: 54..163
Protein Sequence: 187 a.a.     [Download]
>gi|348589448|ref|YP_004873910.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MVTAHQKRKIEGLSKRSHQDYKDKLQPVLLDKLTDEHPERRKELRETATVINYEQLKKSVLRDLSWLLNT
VNLESIESLDGYDHVKSSTINFGVFPVAGQKMSEINQFEIQQQVKAAIIYFEPRILPNDLDVICELEESD
LEHYNVLSLIIKGRLWCNPHPMEFFLRTSVDLESGHMEIKDEGRGSV
 
Nucleotide Sequence: 564 bp     [Download]
>gi|348589352|ref|NC_016043.1|:103308-103871 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGGTTACAGCTCATCAAAAAAGAAAAATAGAGGGCTTATCTAAAAGAAGTCATCAAGACTATAAAGATA
AACTTCAGCCCGTTTTGCTTGATAAGCTTACAGACGAGCATCCAGAACGTAGAAAAGAACTTCGTGAAAC
TGCTACGGTTATTAATTACGAGCAGTTAAAAAAATCGGTTCTTAGAGATTTGAGTTGGCTGCTTAATACA
GTTAATCTTGAGTCTATTGAGTCTCTTGATGGTTATGATCATGTTAAAAGCTCGACCATTAACTTTGGTG
TGTTTCCTGTAGCTGGTCAAAAGATGTCTGAAATTAACCAGTTTGAGATTCAACAGCAAGTTAAGGCAGC
CATTATTTATTTTGAGCCTAGAATACTTCCTAATGACCTTGATGTTATCTGCGAACTGGAAGAGTCTGAC
CTTGAACACTACAATGTATTGTCACTTATAATCAAAGGTAGACTTTGGTGTAACCCTCATCCTATGGAAT
TTTTCTTACGTACATCCGTAGATTTAGAGTCTGGACATATGGAAATAAAGGATGAAGGTAGGGGATCTGT
ATAA
 Primer design