SecReT6
Protein ID: 348589449
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0097
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]103871..105766 [+]
Productprotein ImpG/VasA
NoteTssF
UniProt IDG4QD71
KEGG IDtas:TASI_0097
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-194, Aligned region: 6..630
Protein Sequence: 631 a.a.     [Download]
>gi|348589449|ref|YP_004873911.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MENDFIEYYNRELAYIREMGREFAEQYPKVASRLGMEGIQVADPYVERLMEGFSFLTARIHKKMDAEFPQ
FTQNLLEVLYPHYISPTPAIGIIDFDINSKKGDLVKGYTLPKGTVFRARTGGKECRFSTGHEITFHPVEI
EEAEISSSMSDLPPKLLKNFRGSKQIRSALRIQIKVVGGSTISDLKNFDKLTFFLNGEEIYTHKLLEMLM
AHTIGIVAHDHERPIRWTKFIDVKNLKHEGFEANQSLLPSDSRVFQGYRQLHEYFAFPQRYLFTSLTGVE
KAIALPEELKKQKIKAFELTFLFDKAAHELEGVITAENLRLHSVPVINLFPMQANRINVTPNAHEFHVVV
DRAKPLDYEIYSIDKVTVNAPGQKEVQEFRPFFDIYGANGDSINQFYSLRREVRKPSLNQSQVAKRTGYR
GSEVFISIVDVGNPPYNEQEVFGLNIETTCTNRDLPHIFSSGGDVDFRFNVSVPVDKVHFIKNPSRPRAP
LGREAYSWRLINHLNLNYLNLLDSDEESGAEAVRELLHIYSDLGDPLLARQIQGIRSIKLEPIYRRMPVK
GAIVFGRGVSIKVLLDENEFAGISPYLFGAVLEQFFARHVSINMLTELELSTLQSGIIATWKPRLGGRPT
V
 
Nucleotide Sequence: 1896 bp     [Download]
>gi|348589352|ref|NC_016043.1|:103871-105766 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGGAAAACGATTTTATCGAGTACTATAATCGCGAACTAGCTTACATACGTGAGATGGGGCGTGAGTTCG
CAGAACAGTACCCTAAAGTTGCTAGCCGTTTGGGTATGGAAGGTATACAAGTTGCCGATCCATATGTTGA
ACGCCTTATGGAAGGCTTTAGCTTTCTTACAGCTCGTATTCATAAAAAAATGGATGCTGAGTTTCCTCAG
TTTACGCAAAATCTACTAGAAGTTTTATATCCACACTATATTTCGCCAACACCTGCTATAGGTATTATCG
ACTTTGATATAAATTCTAAGAAAGGTGATTTGGTTAAGGGATATACACTACCTAAAGGTACAGTTTTTAG
AGCCCGTACTGGTGGCAAAGAATGTCGGTTCTCCACTGGACACGAGATAACCTTTCACCCTGTTGAAATT
GAAGAGGCAGAGATTTCATCATCTATGAGCGATTTGCCTCCAAAATTGCTTAAGAATTTTAGAGGAAGTA
AGCAGATTCGCTCTGCCCTTAGAATTCAGATTAAAGTAGTTGGTGGAAGTACGATTTCGGACCTTAAGAA
TTTCGATAAACTCACATTCTTTTTAAATGGTGAGGAAATCTATACCCACAAACTCCTTGAGATGCTCATG
GCACATACTATTGGTATAGTTGCACATGACCATGAAAGACCTATTAGATGGACTAAATTTATCGATGTAA
AAAATTTAAAACATGAAGGATTTGAAGCAAATCAGTCATTATTGCCATCAGACAGTAGGGTATTCCAAGG
ATATAGACAGTTACATGAATATTTTGCGTTTCCACAAAGGTATTTGTTTACAAGTTTAACTGGAGTGGAG
AAAGCGATAGCATTGCCAGAGGAACTTAAGAAACAAAAAATTAAGGCATTTGAACTTACGTTTTTATTCG
ATAAAGCTGCTCATGAACTCGAGGGTGTGATTACTGCCGAGAATTTGCGTTTGCATAGTGTGCCTGTAAT
CAATCTATTTCCTATGCAAGCAAATAGAATTAATGTGACTCCAAATGCTCATGAGTTTCACGTTGTAGTA
GACCGTGCGAAACCTCTGGACTACGAAATTTATTCTATAGACAAGGTTACCGTAAATGCTCCAGGCCAAA
AAGAAGTTCAAGAATTTAGGCCCTTTTTTGATATCTATGGGGCAAATGGAGATTCTATAAATCAGTTTTA
TTCTTTGCGACGCGAAGTTAGGAAGCCTTCTTTAAATCAAAGTCAGGTAGCTAAGAGAACTGGCTATCGA
GGAAGTGAAGTATTTATCTCAATCGTAGATGTAGGTAATCCTCCGTATAATGAGCAAGAGGTGTTTGGAT
TAAATATAGAGACTACATGTACAAATAGAGATTTGCCACATATATTCAGTAGTGGTGGGGATGTTGATTT
TAGGTTCAATGTGTCGGTCCCTGTAGATAAAGTTCACTTTATTAAGAACCCATCTCGACCACGTGCACCG
CTTGGACGTGAGGCCTATTCGTGGCGTCTGATTAATCATTTAAACCTTAACTACTTAAATCTACTGGACT
CGGATGAGGAATCAGGTGCAGAAGCTGTTCGTGAGCTTTTGCATATTTATTCTGATCTTGGGGATCCTTT
ATTGGCTAGGCAGATACAGGGTATTCGTAGCATTAAACTTGAGCCTATTTATAGACGTATGCCAGTGAAA
GGTGCTATTGTTTTCGGTAGAGGCGTTAGTATTAAAGTGCTTCTAGACGAAAATGAATTTGCAGGGATTA
GTCCATATTTGTTTGGAGCAGTGCTAGAGCAGTTTTTCGCAAGGCACGTATCAATTAATATGCTTACAGA
GTTAGAGCTATCAACCTTGCAATCCGGAATCATTGCCACATGGAAACCTAGACTAGGTGGACGGCCCACA
GTCTAA
 Primer design