SecReT6
Protein ID: 348589460
SecReT6 ID462
T6SS typei3
Gene symbol-
Locus tagTASI_0108
StrainTaylorella asinigenitalis MCE3
Repliconchromosome [GenBank: NC_016043] [Browse all T6SS(s) in this replicon]
Location [Strand]118242..119795 [+]
ProductVgrG protein
NoteTssI
UniProt IDG4QD82
KEGG IDtas:TASI_0108
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-75, Aligned region: 23..327
Phage_base_V [PF04717], Evalue: 3.40E-24, Aligned region: 364..456
Protein Sequence: 517 a.a.     [Download]
>gi|348589460|ref|YP_004873922.1| unnamed protein product [Taylorella asinigenitalis MCE3]
MADRHAIAHVAIPSLQFLSLNGHESLSNLYEFEVELVSMDNFIDVRKMLGTQLTVELESFMSTPRYLTGR
VRKFELVGSDQDGSEYLIYKAHVVPPLWYLTQGKDYKIFQEKKIEDIIKEILDKFEIKYEFKLSGSYRNW
EYVVQYNESPFNFISRLMEHEGMYYWFKHDKNESTMVISDDASSHEEYPSYETLNYLSSGFKVFDSREVI
TSWRHNAVVTPSKYTVVDFDFRKPSTALDTEKENQLDGDDSIEVYEWQGGYQELSDGDNYTKLRLEELKV
PQEIVEADSNIRGICPGYKFTLANHPRPSENQDYVVVQAHYMVQVNGYSTNSGREDFFSTSFYSLPASIQ
FRAARRTPEPKTHGPQTATVVGPSGEVIYTDKYGRVKVQFHWDRDGKKDENSSCWVRVSSPWASTGFGGL
QIPRIGDEVVIDFIGGNPDRPLIIGRVYNEDNQPLVNLPNDSHTSGFRTRTIQGGSDNQNFLLFRDKQGD
ELVDVQAEKDMKIFVKNDFYLTVGNCG
 
Nucleotide Sequence: 1554 bp     [Download]
>gi|348589352|ref|NC_016043.1|:118242-119795 Taylorella asinigenitalis MCE3 chromosome, complete genome
ATGGCAGACCGTCACGCAATCGCACATGTAGCGATACCTAGTCTTCAGTTTTTAAGTCTTAACGGGCATG
AATCCCTTTCAAATTTGTATGAATTTGAAGTTGAACTTGTATCTATGGATAATTTTATTGATGTGCGTAA
AATGCTTGGCACACAACTTACTGTCGAATTAGAGTCATTTATGTCCACGCCTAGGTACCTGACTGGTCGT
GTTCGTAAGTTTGAATTAGTTGGATCTGATCAGGATGGTTCAGAATATTTAATTTACAAGGCACATGTTG
TACCTCCTTTGTGGTATCTGACTCAGGGTAAAGATTATAAAATCTTTCAAGAGAAAAAAATCGAAGACAT
AATCAAAGAAATCTTAGATAAATTTGAAATCAAATACGAGTTTAAGCTTTCAGGTTCTTACAGAAATTGG
GAGTATGTAGTTCAATACAATGAATCTCCTTTTAACTTCATTTCAAGATTAATGGAACATGAGGGTATGT
ACTATTGGTTTAAACATGATAAAAACGAATCTACTATGGTTATCTCTGATGATGCTTCATCTCATGAAGA
GTACCCTTCTTATGAAACACTTAATTATTTGTCTTCTGGATTTAAGGTTTTTGATTCCAGAGAGGTTATT
ACTTCTTGGAGACATAATGCAGTAGTTACGCCTTCGAAATATACGGTTGTGGATTTTGATTTTAGAAAGC
CAAGCACTGCATTAGATACAGAGAAAGAAAATCAACTTGATGGTGATGATAGTATTGAAGTTTATGAATG
GCAGGGTGGATATCAGGAATTATCTGATGGCGATAATTATACTAAATTAAGACTGGAAGAATTAAAAGTA
CCTCAGGAAATTGTAGAAGCTGATTCTAATATTCGTGGTATTTGTCCTGGTTATAAGTTTACGCTTGCAA
ATCATCCAAGGCCTTCTGAAAATCAAGATTATGTAGTTGTTCAAGCCCATTACATGGTTCAGGTTAATGG
CTATTCAACCAACTCAGGTAGAGAAGATTTTTTCAGTACTAGCTTTTATTCCTTGCCAGCATCAATACAA
TTCCGTGCGGCTCGTAGAACTCCAGAGCCTAAAACTCACGGACCTCAAACAGCTACTGTTGTCGGCCCTT
CTGGAGAAGTGATTTATACTGATAAATACGGTAGAGTTAAAGTGCAATTCCACTGGGATCGTGATGGTAA
AAAAGATGAGAACTCTTCTTGTTGGGTTCGTGTCTCAAGTCCCTGGGCTAGTACTGGTTTTGGTGGTTTA
CAAATTCCTCGTATTGGAGATGAAGTTGTTATTGATTTTATTGGTGGTAACCCAGATAGACCATTAATTA
TCGGCAGGGTTTATAACGAGGATAACCAGCCTTTAGTTAATCTACCAAATGATTCTCATACCTCAGGCTT
CCGCACAAGAACAATTCAAGGCGGTAGCGACAATCAAAATTTCCTTTTGTTTAGAGACAAACAAGGAGAT
GAATTGGTGGACGTTCAAGCAGAAAAAGATATGAAGATATTTGTTAAGAATGACTTTTACTTAACAGTTG
GTAATTGCGGTTAA
 Primer design