SecReT6
Protein ID: 356875272
SecReT6 ID787
T6SS typei1
Gene symbolevfD
Locus tagEvfD
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]5386..5865 [-]
ProductEvfD
NoteTssM
UniProt IDG8IRL2, G8IRL2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3366 [PF11846], Evalue: 0.0057, Aligned region: 32..107
7tm_7 [PF08395], Evalue: 0.0068, Aligned region: 26..125
Protein Sequence: 159 a.a.     [Download]
>gi|356875272|ref|AET37194.1| EvfD [Escherichia coli RS218]
MFKFPTSRLFSTLKSALRPAMPRFKVSATWLLTLAWIFLLVWIWWQGPKWTLYEQHWLAPLANRWLATAV
WGLIALVWLTWRVMKRLQKLEKQQKQQREEEKDPLTVELHRQQQYLDHWLLRLRRHLDNRRYLWQLPWYM
VIGPAGSWQKHAAARGLSV
 
Nucleotide Sequence: 480 bp     [Download]
>gi|356875267|gb|JN837480|evfD|:5386-5865
GTGTTCAAATTTCCCACATCCCGACTGTTCAGCACGTTGAAATCTGCGCTCAGGCCAGCGATGCCGCGGT
TTAAAGTTTCCGCCACCTGGCTACTGACGCTGGCATGGATTTTTCTGCTGGTGTGGATCTGGTGGCAGGG
TCCAAAATGGACGCTCTATGAGCAGCACTGGCTGGCTCCGCTGGCAAACCGCTGGCTGGCGACCGCCGTC
TGGGGACTTATCGCTCTGGTCTGGCTCACCTGGCGGGTGATGAAGCGTCTGCAAAAGCTGGAAAAACAGC
AGAAACAGCAGCGGGAGGAAGAAAAAGATCCGTTGACCGTGGAACTCCACCGCCAGCAGCAATATCTGGA
TCACTGGCTGCTGCGCCTGCGCCGCCATCTGGATAACCGCCGTTATCTGTGGCAGTTGCCGTGGTATATG
GTCATTGGTCCTGCGGGTAGCTGGCAAAAGCACGCTGCTGCGCGAGGGCTTTCCGTCTGA
 Primer design