SecReT6
Protein ID: 357405284
SecReT6 ID512
T6SS typei3
Gene symbol-
Locus tagMEALZ_1928
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2216808..2220371 [+]
Producthypothetical protein
NoteTssM
UniProt IDG4T2W1
KEGG IDmah:MEALZ_1928
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.70E-97, Aligned region: 198..462
IcmF-related [PF06761], Evalue: 2.50E-78, Aligned region: 509..806
DUF1215 [PF06744], Evalue: 1.10E-37, Aligned region: 702..738
DUF1215 [PF06744], Evalue: 1.10E-37, Aligned region: 926..1048
Protein Sequence: 1187 a.a.     [Download]
>gi|357405284|ref|YP_004917208.1| hypothetical protein MEALZ_1928 [Methylomicrobium alcaliphilum 20Z]
MKKIIGFFKNKWVIQLIGIIAVGLLIWFFGPLIAIAGSVPLESEVSRLITILVIVLLWGLNNLRIQVKAN
RANTQMVNELVGGAQGTTGPSQVEQDSEEEIGELGKHFDDALRTLKQIKTQSGQGRQYLYELPWYIIIGP
PGSGKTTALINSGLEFPLADKFGKNAVKGVGGTRNCDWWFTDQAVLLDTAGRYTTQDSHEAVDKAAWLGF
LNLLKKHRPRRPVNGVLITMSLSDLIKQTEEERIQHAQAIRQRIQELHEHFGIRFPIYMLFTKCDLIAGF
NDFFADLGKEERAQVWGVTFPEEDQDHPIDAVGRVGDDFDGLLDRLNARLPKRLQEERDLQRRHSIFGFP
QRMALLKESLLEFLKECYGANRYQQAPYLRGVYFTSGTQEGTPIDRLMGILASTFKLDRFLVPMFSGKGK
SFFITRLLKDVIFDEALIVGLNKRVERRYALLRQVAYGSALAVTLLMAALWTFSFTRNQSALNELSQKIE
QYEQTAANYPNRSDFADLLKRMNAMQDIQRVYGDEKPLSMRFGLFQGNKVQPVINDTYDQVLLKQFLPLI
KTRLEQRIRGEEANNPEILYELLKVYLMFGEPKRLEPGLVRPWIAIDWKKNYADDVQVGLLGHLDNLLEL
KIEPQLLDQRLVAATRQVLNRIPVAQQVYMRIKSEAMQDGSRDLRLSDALGPNASRVFTVASGKFEQQTI
PYLFTHDGFYQVFLKQNQALAKETVEDNWVLGDVGRARAPDPERLQQDVQTYYDKDFIQYWSDMLGNLKI
RSVGNIQQSIELLEFASAPNSPIRLLLETIDKETSLTRKPPSPLDALAAVKEGAEKTVDSRTQKLLQAAQ
AEGVVQAPTDPPGTVVERHFQPLASLVRSVGGAGAPFDQTINLLGQLYGFMIDLGSTSDSGGAAIRIAAQ
RSEGGGGGDVMSRMKMESARLPEPLKSMTEKLSSGNLNLIMGSSKAQLNKLWQSEVMPLYKSGLEGRYPL
SRRATREITLQDFSRFFAPNGILDQFFNANLKPFVDTSGRTWRLITQNNQSIGISRSVLMQFQYAAKIRE
VFFQGGSQLPSVRFNLRPVSLDAKASRFWLNLEGQQLDYRHGPARSTQLQWPGTDGSGSVRYGFDTLDGR
QVSRSEEGAWAWFKLLDKARIQITAQDRFMLTFAIDNLEARYELSATSVDNPFALKELQNFQFPTSL
 
Nucleotide Sequence: 3564 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2216808-2220371 Methylomicrobium alcaliphilum chromosome, complete genome
GTGAAAAAAATCATCGGTTTCTTCAAAAATAAATGGGTCATTCAACTGATCGGTATTATTGCCGTCGGCC
TGTTAATTTGGTTTTTCGGGCCGCTCATTGCGATAGCAGGAAGTGTCCCCCTTGAGTCCGAAGTTTCCAG
GCTAATTACGATTCTAGTGATCGTCTTGCTCTGGGGATTGAATAATCTACGCATTCAGGTCAAAGCCAAT
CGTGCCAATACGCAAATGGTCAATGAGCTGGTCGGAGGCGCCCAAGGAACGACCGGGCCCAGTCAAGTCG
AGCAAGATAGCGAGGAGGAAATCGGCGAACTCGGCAAGCATTTCGACGATGCGCTACGCACGCTAAAACA
AATCAAAACTCAGTCGGGCCAGGGTCGTCAATATCTCTATGAATTACCCTGGTATATCATCATCGGGCCG
CCGGGCTCCGGAAAAACCACCGCATTGATCAATTCGGGACTGGAGTTTCCGCTGGCCGACAAATTCGGCA
AAAACGCGGTCAAAGGCGTCGGCGGGACCCGCAATTGCGATTGGTGGTTTACCGATCAAGCGGTGCTGTT
GGATACCGCTGGACGCTATACGACGCAAGACAGTCACGAGGCAGTCGATAAGGCGGCATGGCTCGGTTTT
TTAAATTTGCTGAAAAAACATCGGCCGCGCAGACCGGTCAACGGCGTGCTGATCACGATGAGCCTGTCCG
ATTTGATCAAGCAGACCGAGGAGGAGCGAATTCAACATGCGCAAGCGATTCGGCAGCGTATTCAGGAGTT
GCACGAACATTTCGGCATTCGCTTTCCGATCTATATGCTGTTTACCAAATGCGATCTGATTGCAGGTTTC
AACGACTTCTTTGCCGATCTAGGCAAAGAAGAAAGAGCCCAAGTTTGGGGTGTTACTTTTCCTGAAGAAG
ATCAAGATCACCCTATCGATGCTGTTGGTCGGGTCGGCGATGATTTTGATGGCCTGCTGGATCGTTTGAA
TGCGCGTTTGCCGAAAAGACTTCAAGAAGAGCGCGACTTGCAGCGCCGTCATTCGATTTTCGGCTTTCCG
CAACGCATGGCTTTGCTGAAAGAGAGTTTGTTGGAGTTTCTCAAAGAGTGTTACGGCGCGAACCGATATC
AACAAGCCCCTTATCTCAGAGGCGTTTATTTTACCAGCGGGACGCAAGAAGGCACGCCGATCGACCGTCT
GATGGGGATTTTGGCGAGTACTTTCAAACTCGATCGTTTTTTGGTGCCGATGTTCAGTGGCAAGGGAAAG
AGTTTTTTCATTACCCGTTTGCTGAAAGATGTCATTTTCGACGAAGCGCTGATCGTCGGTTTGAACAAAC
GCGTAGAGCGTCGTTATGCCTTGCTTCGTCAGGTTGCATACGGTTCGGCACTGGCTGTGACATTATTAAT
GGCGGCCTTATGGACTTTTAGTTTTACTCGAAATCAGTCGGCATTGAACGAGCTGAGTCAAAAGATTGAA
CAATACGAACAAACCGCGGCGAATTATCCGAATCGATCGGACTTTGCCGACTTATTGAAACGCATGAATG
CGATGCAAGACATTCAACGAGTTTATGGCGACGAAAAGCCCTTGTCGATGCGTTTCGGCTTGTTTCAAGG
CAACAAAGTGCAACCGGTCATTAACGATACTTATGATCAAGTTTTATTGAAGCAATTTTTACCATTGATC
AAGACAAGGCTAGAACAACGTATCCGAGGCGAAGAGGCGAATAACCCCGAAATTCTCTATGAACTCTTAA
AAGTATATTTGATGTTCGGCGAGCCCAAACGGCTCGAGCCAGGCTTAGTGCGGCCTTGGATTGCTATCGA
TTGGAAAAAAAATTATGCCGACGATGTTCAAGTCGGCTTGCTCGGCCATCTCGATAATTTGCTCGAGCTA
AAAATAGAGCCCCAGCTGCTCGACCAACGGTTAGTCGCCGCAACGCGGCAAGTGTTAAACCGCATTCCTG
TTGCGCAGCAAGTCTATATGCGCATCAAGAGCGAGGCGATGCAGGATGGCAGCCGCGATCTCCGTTTGTC
GGATGCGCTAGGGCCTAATGCGTCTCGGGTTTTTACGGTCGCGTCCGGAAAATTCGAACAGCAAACCATT
CCTTATTTGTTCACACACGACGGTTTTTATCAAGTATTTCTAAAACAAAACCAAGCTTTGGCGAAAGAGA
CGGTCGAGGATAATTGGGTGTTGGGCGATGTCGGTAGAGCCCGCGCGCCCGATCCCGAACGCTTGCAGCA
AGACGTTCAGACCTATTACGACAAGGATTTCATTCAGTATTGGAGCGATATGCTTGGCAATCTAAAAATC
AGAAGCGTCGGTAATATTCAACAATCGATCGAATTACTCGAATTCGCTTCGGCGCCCAACTCGCCGATTC
GACTATTATTGGAGACTATCGACAAGGAAACTTCCCTAACACGCAAACCGCCAAGTCCTTTGGATGCTTT
GGCGGCGGTCAAGGAAGGCGCGGAAAAAACAGTAGATTCGCGCACGCAAAAACTGTTGCAAGCCGCACAA
GCCGAAGGTGTCGTGCAAGCACCGACCGATCCGCCGGGCACAGTCGTCGAGCGCCATTTTCAACCGCTAG
CTTCATTGGTAAGGAGCGTCGGCGGCGCAGGCGCGCCATTCGATCAGACCATCAATCTGCTCGGTCAATT
GTACGGTTTTATGATCGATTTGGGCAGTACTTCAGATAGCGGCGGCGCGGCAATAAGGATCGCCGCTCAG
CGCAGCGAAGGGGGCGGCGGAGGCGATGTCATGTCGCGCATGAAAATGGAATCGGCGCGTTTGCCAGAAC
CGTTAAAAAGCATGACCGAAAAACTGTCCAGCGGCAATTTGAATCTGATCATGGGGTCGAGCAAGGCGCA
GCTCAATAAGCTTTGGCAGAGCGAGGTCATGCCGCTTTATAAATCGGGACTCGAAGGCCGTTATCCGCTG
TCCAGACGCGCCACTCGAGAAATTACTTTGCAAGATTTTAGCCGGTTTTTTGCACCGAACGGTATCCTGG
ATCAGTTTTTCAATGCCAATCTCAAACCTTTTGTCGATACCAGCGGCCGAACCTGGCGATTGATCACTCA
AAATAATCAATCGATCGGTATTTCGCGATCAGTGCTGATGCAGTTTCAATATGCGGCAAAAATCCGTGAA
GTATTTTTTCAAGGCGGTAGTCAATTACCCTCGGTTCGATTCAATCTTAGACCGGTATCGCTTGATGCCA
AAGCTTCACGGTTTTGGCTGAATTTGGAAGGTCAGCAATTGGATTACCGGCATGGTCCGGCGCGAAGTAC
GCAACTGCAGTGGCCTGGAACGGACGGAAGCGGTTCTGTGCGTTACGGTTTCGATACCTTAGACGGCCGT
CAAGTCAGCCGTTCCGAGGAGGGCGCTTGGGCATGGTTTAAGCTGCTTGATAAAGCCCGAATTCAAATTA
CCGCGCAAGACAGGTTCATGCTGACATTCGCAATCGACAACTTGGAAGCGCGTTATGAATTGAGCGCGAC
CAGCGTCGATAATCCTTTTGCGCTCAAAGAACTGCAAAATTTTCAATTTCCAACGAGCTTGTAA
 Primer design