SecReT6
Protein ID: 365970986
SecReT6 ID514
T6SS typei3
Gene symbol-
Locus tagEcWSU1_02694
StrainEnterobacter cloacae EcWSU1
Repliconchromosome [GenBank: NC_016514] [Browse all T6SS(s) in this replicon]
Location [Strand]2786016..2789636 [-]
Producthypothetical protein
NoteTssM
UniProt IDG8LFE2
KEGG IDeec:EcWSU1_02694
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.10E-99, Aligned region: 208..483
ImcF-related_N [PF14331], Evalue: 3.10E-99, Aligned region: 762..811
IcmF-related [PF06761], Evalue: 1.00E-91, Aligned region: 531..834
DUF1215 [PF06744], Evalue: 1.30E-29, Aligned region: 947..1072
AAA_10 [PF12846], Evalue: 0.0085, Aligned region: 145..166
AAA_10 [PF12846], Evalue: 0.0085, Aligned region: 803..962
Protein Sequence: 1206 a.a.     [Download]
>gi|365970986|ref|YP_004952547.1| hypothetical protein EcWSU1_02694 [Enterobacter cloacae EcWSU1]
MLTTLLSILTNRILWSFLGVTALAAVIWMIGPLLSIVDTRPLESEQNRIISIAVVYLLWAQGHILPRLYN
AWLNRKLMDKLNENTTSPEAADPQKRLNNEEQILASRFDEAAQMLKKAHFSKAGQGAQWTQRFSTQYLYQ
LPWYVIIGAPGSGKTTALVNSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESEQV
QDAGEWLEFMGLLRKYRRRQPINGVIITISISDLLTLSPEASRQQAVNLRQRLSELHEQLGIRFPVYVMV
TKADLLKGFRAWFADYDKAQRDQIWGFTLPWEQTKHADYDLMGNFQQEFSLLQQRLDAGLPETLLQEHDA
KARAEAYLFPQEFAALRPLLADYLSTVFARSNFETEFSPRGIYFASGTQEGMPFDRVMGELNRALSLPEG
EEGNRWDSVSKEAPIPGAKGQSFFIKNLLQNVIFQEAGIAGENRWWELRNRAVIWSGYAALLALLVILGG
LWLTSYARNKAYLEEVDAKVPLLDQQSKALQNQPQRDLFDLLPLLNGLVDLPKSDAFDVNDPPVSRRMGL
YRGDDVSDASQSLYQKALDQMLLPAVAMHITTWLRNDNGSDVEYSYEALKAYQMLYQPKHYDGKFLHSWV
MLNLQRNLPQNVTQAQLQQLEWHLTQLLEPKIQASPYAQDESLVARERALINQQPLSTRVYGRLKRLLEH
DENLKPVSLSDLGGPQSELVFSRKSGKPVSEGVPGLYTPDGYWKSFNGQIDSVTTALHEDDAWVLGATSA
QEDKQQIDNAVRQLYMRDFIANWDRFLADIQLNNSADLSQRINTARLLSGANSPLRRLVLNLSQVLTLSR
NAPAPDDAGKAQAQSNRATRTLEALFSNNDNAPTQAAVVTQAPEQLVTDHYAPMIELAQPLEKGGKTIVF
DDFLKQVDELYRYLTAVQDAANSGMPAPGGEAISRLQASAGRLPGGLQTMFSNMAVGASSDTQRRDLENV
RKRINVEVGGFCRQAIAGRYPLVRSASTEVTPDDLARMFAPGTGLMDTFFRDNLTNKVDTTQANWRFMPG
IDGKTLPGSEGLLRPFQQAQSIRDAFFANGATTPSYKVTVRTVRMDNTILNLTLDVDGQLLRYSHGPQAV
QIMNWPGPGGTNQVRMQLGLANGSTATLVTNGSWALNRFFDKARTSPGAGSLSRQATFNVDGHQVTLEFA
PNSIRNPFQLPRFSCP
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|365968300|ref|NC_016514.1|:c2789636-2786016 Enterobacter cloacae EcWSU1 chromosome, complete genome
ATGCTGACTACTCTTCTTTCCATTTTGACCAATCGCATTCTGTGGAGCTTCCTGGGCGTCACTGCGCTTG
CGGCGGTTATCTGGATGATTGGCCCATTGTTGTCCATCGTGGACACCCGACCGCTCGAATCTGAACAGAA
CCGCATCATCAGTATTGCGGTGGTTTATCTGCTCTGGGCTCAGGGCCACATTCTGCCGCGGCTGTACAAT
GCCTGGCTGAACCGCAAGCTGATGGACAAACTCAATGAGAACACCACCAGCCCGGAAGCAGCGGATCCGC
AGAAGCGACTGAACAACGAGGAGCAGATCCTCGCCAGCCGTTTTGACGAAGCCGCACAGATGCTGAAAAA
AGCGCACTTCAGCAAAGCGGGACAGGGTGCCCAGTGGACGCAGCGCTTTAGCACACAGTATCTGTATCAA
CTGCCGTGGTACGTCATCATCGGCGCGCCGGGCAGCGGTAAAACCACGGCGCTGGTCAATTCCGGACTGC
AATTCCCGCTGGCCGACCGTTTCGGTAAGACCGCGCTGCGCGGGATCGGCGGCACGCGTAACTGCGACTG
GTGGTTCACCAACGAAGCCGTACTGCTGGACACCGCGGGTCGCTATACCACCCAGGAGAGCGAACAGGTT
CAGGACGCCGGTGAATGGCTTGAGTTTATGGGGTTACTGCGTAAGTATCGCCGTCGCCAGCCGATCAACG
GTGTGATTATTACCATCAGCATTTCTGACCTGCTGACGCTCTCGCCTGAAGCGTCACGCCAGCAGGCTGT
CAACCTGCGCCAGCGTCTCTCTGAGCTGCATGAGCAACTGGGTATTCGCTTCCCGGTGTATGTCATGGTG
ACCAAAGCTGACCTGCTTAAAGGCTTCCGTGCCTGGTTTGCCGATTACGACAAAGCGCAGCGCGACCAGA
TCTGGGGCTTCACGCTGCCGTGGGAGCAAACCAAACACGCTGATTACGACCTGATGGGTAACTTCCAGCA
GGAATTTTCCCTCTTACAGCAGCGCCTGGATGCCGGACTGCCGGAAACTCTGCTGCAGGAGCATGACGCA
AAAGCGCGCGCGGAAGCGTATCTCTTCCCGCAGGAGTTTGCCGCACTGCGTCCGCTGCTGGCTGACTACC
TGAGCACGGTCTTTGCCCGCTCTAACTTTGAAACCGAATTCTCCCCGCGCGGGATCTATTTCGCCAGTGG
TACCCAGGAAGGCATGCCGTTTGACCGGGTGATGGGCGAACTTAACCGTGCGCTCTCCTTGCCGGAAGGT
GAAGAGGGAAATCGCTGGGATTCCGTCAGCAAAGAGGCTCCGATCCCGGGGGCGAAAGGGCAGAGCTTCT
TCATCAAGAACCTGCTGCAAAACGTCATTTTCCAGGAAGCCGGCATCGCCGGGGAAAACCGCTGGTGGGA
ACTGCGTAACCGCGCCGTCATTTGGTCCGGCTATGCGGCGCTGCTGGCCCTACTGGTGATCCTCGGTGGA
CTGTGGCTGACCAGCTATGCCAGAAACAAGGCTTATCTGGAAGAGGTGGACGCAAAGGTGCCGCTGCTGG
ATCAGCAGAGCAAGGCGCTGCAGAATCAGCCTCAGCGCGATCTGTTTGACCTTCTGCCCTTGCTGAATGG
CCTGGTCGATCTGCCGAAAAGTGACGCGTTTGATGTTAACGATCCGCCTGTCTCACGCCGTATGGGGCTC
TATCGTGGCGATGACGTCAGCGATGCATCGCAGTCTCTGTACCAGAAAGCGCTGGACCAGATGCTGCTCC
CTGCCGTGGCGATGCATATCACCACCTGGCTGCGCAACGATAACGGCAGCGATGTGGAATACAGCTATGA
AGCGCTGAAGGCCTACCAGATGCTCTATCAGCCGAAGCACTACGACGGCAAATTCCTGCACTCCTGGGTA
ATGCTTAATCTGCAGCGTAACCTGCCGCAGAACGTGACTCAGGCGCAGCTTCAGCAGCTTGAGTGGCACC
TGACTCAGCTGCTTGAACCGAAAATTCAGGCCTCGCCGTACGCGCAGGATGAATCCCTGGTCGCGCGTGA
AAGGGCGCTAATCAACCAGCAGCCACTTTCCACCCGGGTGTATGGTCGTCTGAAGCGTCTGCTGGAGCAT
GATGAAAACCTGAAACCGGTGTCGCTCTCCGACCTGGGCGGTCCGCAGAGCGAGCTGGTGTTTTCACGCA
AAAGCGGCAAGCCGGTGAGTGAAGGCGTACCGGGTCTTTATACCCCGGACGGTTACTGGAAAAGCTTCAA
CGGCCAGATTGACAGCGTCACCACTGCCCTGCATGAAGACGATGCGTGGGTGCTGGGGGCGACCTCAGCC
CAGGAAGATAAACAGCAGATCGATAACGCCGTGCGCCAGCTCTACATGCGCGACTTTATCGCCAACTGGG
ATCGCTTCCTCGCCGACATTCAGCTTAATAACAGCGCCGATCTCTCCCAGCGTATCAATACCGCGCGTCT
GCTCTCCGGGGCAAACTCGCCGCTGCGCCGTCTGGTGCTGAACCTGAGCCAGGTCCTGACGCTTTCACGT
AATGCGCCAGCCCCGGACGATGCCGGTAAAGCGCAAGCGCAAAGCAACCGTGCCACCCGCACGCTCGAAG
CGTTATTCAGTAATAATGACAATGCCCCGACGCAGGCCGCGGTGGTCACTCAGGCACCTGAACAGCTGGT
AACCGATCACTATGCTCCAATGATTGAGCTGGCGCAGCCGCTGGAGAAGGGCGGGAAGACCATCGTCTTT
GATGATTTTCTCAAGCAGGTCGATGAACTTTACCGCTACCTGACTGCCGTTCAGGACGCGGCCAACAGCG
GCATGCCTGCTCCGGGAGGCGAGGCGATTAGCCGTCTGCAGGCCAGTGCCGGTCGTCTGCCGGGCGGTCT
GCAAACCATGTTCAGCAATATGGCGGTGGGGGCCAGCAGTGATACCCAGCGTCGCGACCTCGAAAACGTG
CGTAAGCGGATTAACGTCGAAGTCGGTGGTTTCTGCCGTCAGGCAATCGCTGGCCGTTACCCGCTGGTGC
GCAGCGCCAGTACGGAGGTCACGCCGGACGATCTCGCGCGCATGTTTGCGCCAGGCACCGGGCTGATGGA
CACCTTCTTTCGTGACAACCTGACCAATAAAGTCGATACCACGCAGGCGAACTGGCGCTTTATGCCGGGC
ATTGATGGAAAAACGCTGCCCGGAAGTGAAGGGCTCCTGAGACCGTTCCAGCAGGCGCAGTCCATTCGCG
ATGCTTTCTTTGCTAACGGTGCCACCACGCCATCTTACAAAGTGACGGTGCGCACCGTCAGAATGGATAA
CACAATCCTTAACCTGACGCTGGATGTTGACGGTCAACTGCTGCGCTACAGCCACGGTCCACAGGCTGTG
CAGATCATGAACTGGCCGGGGCCGGGCGGGACTAACCAGGTGCGTATGCAGCTGGGTCTGGCTAACGGCA
GCACGGCTACGCTGGTGACTAACGGTTCCTGGGCGCTGAACCGCTTTTTCGATAAAGCGCGTACCAGCCC
GGGGGCGGGAAGTCTGAGTCGCCAGGCGACCTTCAACGTAGACGGACATCAGGTTACGCTGGAATTTGCG
CCAAACAGTATTCGTAACCCGTTCCAGCTTCCCCGTTTCTCATGCCCATAA
 Primer design