SecReT6
Protein ID: 374291535
SecReT6 ID525
T6SS typei5
Gene symbol-
Locus tagAZOLI_0999
StrainAzospirillum lipoferum 4B
Repliconchromosome [GenBank: NC_016622] [Browse all T6SS(s) in this replicon]
Location [Strand]925575..929216 [-]
Productputative Type VI secretion protein IcmF-like
NoteTssM
UniProt IDG7Z5V7
KEGG IDali:AZOLI_0999
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.70E-87, Aligned region: 93..115
ImcF-related_N [PF14331], Evalue: 1.70E-87, Aligned region: 199..461
IcmF-related [PF06761], Evalue: 2.50E-87, Aligned region: 518..820
DUF1215 [PF06744], Evalue: 4.90E-39, Aligned region: 948..1072
Protein Sequence: 1213 a.a.     [Download]
>gi|374291535|ref|YP_005038570.1| putative Type VI secretion protein IcmF-like [Azospirillum lipoferum 4B]
MLKSILSALTSRWFLTLVAALCLGAIVWFLGPLVAVSGAFPLEDATVRLAVVFGILLVWALAMQWSLYRH
RSANDRMVQALAKATPAAKGDPDSEAVGQETDLLRGRLREALDQLRKARFGGKWGQRYLYQLPWYLLIGA
PGAGKTTALANSGLRFPLAAEMGRAALRDVGGTRNCDWWFTDEAVLIDTAGRYITQDSQPAIDGKVWKNF
ITLLKRHRPRQPVNGILLAVSLADLALWSEPERKGHAEQLKLRLKELRGQVGSRVPVYVLLTKADLIAGF
AEFFDDLSREEREQVWGVTFPLDDGKSGDDAPVYRFGTEFDALTGRIARRVLDRVHGESDIQRRSLDTLF
PAQIAALKPAIADLLMVIFEPNRYEERALLRGVYLTSGTQDGAPVDRLSEMVAGSFGLDRPVLPAASGGR
SFFLTRTLREVVFAEAGLVGTNSGLERRWRLLRGGAMVAMLLAGLGIAAFWANSFTGNAALVAGVDAAAA
KAQAELAPLATAPRSLAKVDDTDFITIVPPLNTLRAIPAGWTDPVPLEMTGGLYQGDRLGRQSETVYDRA
LRTILLPRVFLRVEEQLRRERGRPEYLFQALKVYLMLAGKGPLDKGLVSDWMALDWMASLPGPAYDGVRS
DLRVHLDAMLAAPLSSIEPDEALVEEARQSLTRYPLAERGFAILRDRPEIQALADWRLVDHAGPLAGRVL
IRPSGKPLSEGVPGLYSYDGFHKAVLPALPKVAKALVDENWVLGQPSSGPQAVASAQRLEKGILAVYLDR
YARQWDELLGDVVIVPLRSLNQAADVLNTLSGPQSPLKLWLTAMVRETTLAPGPNDKPADGKGPVAGGPL
AGIAQQAQAGEKAVESTGTNAAYLARLAGVSLQPEGPPPGQPINDHFKALRDLVQGEGGAPPKLDESLKL
LGELYQQIARAANAPDQNGALLAGLAGGADKGAVAAQLRNLARDLPDPVGGMVATVAQSAATVSAGGARS
QINKAWQSTVLPFCRAALDNRFPMVPNSQVDVTAADFAKLFAPGGMIDQFFNTNLRPFVDMTVSPWAWQK
VDQVDLGIPPAVLDQFERAARIRDSLFPAGAATAKVVFEITPVELDAKATQVALDVDGQTLIYQHGPPRP
QVMKWPGAEGTSSVRLGFGPPLPGEPAGISRQGPWALFHFLADGKLESTPQPDRFTFAVTVGTRKAVFAL
RADSVNNPFGKNLLESFRCPTAL
 
Nucleotide Sequence: 3642 bp     [Download]
>gi|374290655|ref|NC_016622.1|:c929216-925575 Azospirillum lipoferum 4B, complete genome
ATGCTGAAATCGATCCTGTCCGCCCTGACCTCCCGCTGGTTCCTGACGCTGGTCGCGGCGCTGTGCCTGG
GCGCCATCGTCTGGTTCCTGGGGCCACTCGTCGCCGTGTCGGGCGCCTTCCCGCTGGAGGACGCGACCGT
CCGGCTGGCGGTGGTCTTCGGCATCCTGCTGGTCTGGGCGCTGGCGATGCAATGGTCGCTCTACCGCCAC
CGCAGCGCCAACGACCGCATGGTGCAGGCGCTCGCCAAGGCGACGCCGGCCGCCAAGGGCGATCCGGATT
CGGAGGCCGTCGGCCAGGAGACCGACCTGCTGCGCGGCCGCCTGCGCGAGGCGCTGGACCAGCTGCGCAA
GGCGCGTTTCGGCGGCAAATGGGGGCAGCGCTATCTCTACCAGCTTCCCTGGTATCTGCTGATCGGTGCG
CCGGGGGCGGGCAAGACCACGGCGCTGGCCAATTCCGGCCTGCGCTTCCCGCTGGCGGCAGAAATGGGGC
GGGCGGCACTGCGCGACGTTGGCGGCACCCGCAACTGCGACTGGTGGTTCACCGACGAGGCGGTGCTGAT
CGACACCGCCGGCCGCTACATCACCCAGGACAGCCAGCCGGCCATCGACGGCAAGGTGTGGAAGAACTTT
ATTACCCTGCTGAAGCGCCACCGCCCGCGCCAGCCGGTCAACGGCATCCTGCTGGCCGTCAGCCTCGCCG
ACCTCGCGCTGTGGAGCGAGCCGGAGCGCAAGGGACATGCCGAACAGCTGAAGCTGCGGCTGAAGGAGCT
GCGCGGACAGGTCGGGTCGCGCGTCCCGGTCTATGTGCTGCTGACCAAGGCCGACCTGATCGCCGGTTTC
GCCGAGTTCTTCGACGACCTCAGCCGGGAGGAGCGCGAACAGGTCTGGGGCGTCACCTTCCCGCTGGATG
ACGGCAAGAGCGGCGACGACGCGCCGGTCTACCGCTTCGGCACGGAATTCGACGCGCTGACCGGGCGCAT
CGCCCGCCGGGTGCTCGACCGCGTGCATGGCGAATCCGACATCCAGCGCCGCTCGCTCGACACCCTGTTC
CCGGCGCAGATCGCGGCACTGAAGCCGGCCATCGCCGACCTGCTGATGGTCATCTTCGAGCCCAACCGCT
ACGAGGAACGGGCACTGCTGCGCGGCGTCTACCTGACCAGCGGCACCCAGGACGGCGCGCCGGTCGACCG
TTTGTCGGAGATGGTGGCGGGGTCCTTCGGGCTCGACCGTCCGGTCCTTCCGGCGGCCAGCGGCGGGCGC
AGCTTCTTCCTGACCCGCACCCTGCGCGAGGTGGTCTTTGCCGAGGCCGGGCTGGTCGGCACCAATTCCG
GGCTGGAGCGGCGGTGGCGCCTGCTGCGCGGCGGGGCGATGGTGGCGATGCTGCTGGCCGGGCTGGGGAT
CGCCGCCTTCTGGGCCAACAGCTTCACCGGCAACGCCGCGCTGGTCGCCGGGGTCGATGCGGCCGCCGCC
AAGGCGCAGGCCGAGCTGGCGCCGCTCGCCACCGCGCCGCGGTCGCTGGCCAAGGTCGACGACACCGATT
TCATCACCATCGTGCCGCCGCTGAACACGCTGCGCGCCATCCCCGCCGGCTGGACCGATCCGGTGCCGCT
GGAGATGACCGGCGGCCTCTATCAGGGCGACCGGCTGGGACGGCAGAGCGAGACCGTCTATGACCGCGCG
CTGCGCACGATCCTGCTGCCGCGCGTCTTCCTGCGGGTGGAGGAGCAGCTGCGCCGAGAGCGCGGCCGGC
CGGAGTACCTGTTCCAGGCGCTGAAGGTCTACCTGATGCTGGCCGGCAAGGGGCCGCTGGACAAGGGGCT
GGTGTCGGACTGGATGGCGCTCGACTGGATGGCCTCGCTGCCCGGCCCGGCCTATGACGGCGTGCGGAGC
GACCTGCGCGTCCATCTCGACGCCATGCTGGCGGCCCCGCTCTCGTCCATCGAACCGGATGAGGCATTGG
TGGAGGAGGCGCGGCAAAGCCTGACGCGCTATCCGCTGGCCGAACGCGGCTTCGCCATCCTGCGCGACCG
GCCGGAGATCCAGGCGTTGGCCGACTGGCGGCTGGTCGACCATGCCGGGCCGCTGGCCGGCCGGGTGCTG
ATCCGCCCATCGGGCAAGCCGTTGTCGGAGGGGGTGCCCGGCCTCTACAGCTATGACGGCTTCCACAAGG
CGGTGCTGCCGGCGCTGCCCAAGGTCGCCAAGGCGCTGGTGGACGAAAACTGGGTGCTGGGCCAGCCGAG
CAGCGGCCCGCAGGCGGTCGCCAGCGCGCAACGGCTGGAGAAGGGCATCCTCGCCGTCTATCTCGACCGC
TATGCCCGCCAGTGGGACGAGCTGCTGGGCGACGTGGTAATCGTGCCGCTGCGCAGCCTGAATCAGGCCG
CCGACGTGCTGAACACGCTGTCCGGCCCGCAATCGCCGCTGAAGCTGTGGCTGACCGCCATGGTGCGCGA
GACCACGCTGGCGCCCGGCCCGAATGACAAACCAGCCGACGGCAAGGGGCCGGTTGCCGGCGGTCCGCTG
GCCGGGATTGCCCAGCAGGCGCAGGCCGGCGAGAAGGCGGTGGAGTCGACCGGCACCAACGCCGCCTATC
TGGCGCGGCTGGCCGGCGTCTCGCTGCAGCCGGAAGGACCGCCGCCGGGCCAACCGATCAACGACCATTT
CAAGGCTCTGCGCGATCTCGTGCAGGGCGAGGGCGGGGCGCCGCCCAAGCTGGATGAATCGCTGAAGCTT
CTGGGCGAGCTCTACCAGCAGATCGCCCGCGCGGCCAACGCGCCCGACCAGAACGGCGCGTTGCTGGCCG
GGCTGGCCGGCGGTGCCGACAAGGGGGCGGTGGCCGCACAGCTGCGCAACCTCGCCCGCGACCTGCCCGA
CCCGGTCGGCGGCATGGTCGCCACTGTGGCGCAGAGTGCGGCGACCGTCAGCGCCGGCGGTGCGCGGTCG
CAGATCAACAAGGCGTGGCAATCCACCGTCCTGCCCTTCTGCCGGGCGGCGCTGGACAACCGGTTCCCGA
TGGTGCCGAACAGTCAGGTCGATGTGACGGCGGCGGATTTCGCCAAGCTGTTCGCGCCGGGCGGCATGAT
CGACCAGTTCTTCAACACCAACCTGCGCCCCTTCGTCGACATGACGGTCAGCCCCTGGGCCTGGCAGAAG
GTCGATCAGGTCGATCTCGGCATTCCGCCCGCGGTGCTTGACCAGTTCGAGCGCGCCGCGCGCATCCGCG
ACAGCCTGTTCCCCGCCGGGGCCGCCACCGCGAAAGTGGTGTTCGAGATCACGCCGGTGGAGCTGGACGC
CAAGGCGACCCAGGTGGCGCTCGACGTCGACGGCCAGACGCTGATCTACCAGCACGGCCCGCCCCGCCCG
CAGGTGATGAAATGGCCGGGGGCGGAGGGCACCAGCAGCGTGCGCCTCGGCTTCGGCCCGCCGCTGCCGG
GTGAGCCGGCCGGCATCTCGCGCCAGGGTCCCTGGGCCTTGTTCCATTTCCTCGCCGACGGCAAGCTGGA
GTCCACGCCGCAGCCCGACCGCTTCACCTTCGCGGTGACGGTGGGCACCCGCAAGGCGGTCTTCGCCCTG
CGGGCCGACAGCGTGAACAACCCCTTCGGCAAGAACCTGCTGGAGAGTTTCCGATGCCCGACGGCTCTGT
AG
 Primer design